(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE350

MICSR_1.PE350        Location/Qualifiers
FT   CDS_pept        complement(677928..678767)
FT                   /codon_start=1
FT                   /gene_family="HOG000237461" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636980"
FT                   /orf_name="MICPUN_79533"
FT                   /product="Glycosyltransferase family 2 protein "
FT                   /function="transferase activity"
FT                   /protein_id="ACO62194.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG477361"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="UniParc:UPI000199A82E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M7"
FT                   /transl_table=1
FT                   /translation="MRLSVVVPALNEERNVARAVASAREGAGAADHFEVVVVDGGSDDA
FT                   TVSVAHSAGADAVLVSPERGRAAQLARGVERCSGDVIVFLHADSTLPDGYAEKLRDAMK
FT                   PEHSWGAFGFRLAPEERDDDDDAADPSTAARGSKGPGGGTARRFLEWCVDKRTKWLGAP
FT                   YGDQGVWVKRHALDSVGGVPQQCFMEDYELVKRLRRRHGMPCVVDAAVTTSSRRWDAMG
FT                   VARVTALNQLIVFGYAMGVAPERLARWYTAGRNMGGGTKRWDTRAEANAEATKVEER"
     atgcggctct ccgtcgtggt cccggcgctc aacgaggagc gcaacgtcgc gcgcgccgtc        60
     gcgagcgcgc gcgagggcgc cggcgccgcg gatcacttcg aggtcgtggt ggtcgacggc       120
     ggcagcgacg acgcgaccgt ctccgtcgcg cacagcgcgg gcgcggatgc cgtgctcgtc       180
     tcaccggaga ggggacgcgc cgcgcagctc gcgcgagggg tggagcgatg cagcggcgac       240
     gtcatagtct tcctccacgc ggactccacc ctcccggacg ggtacgcgga gaagttgcgc       300
     gacgcgatga agcccgagca cagctggggc gcgttcgggt tcaggctcgc ccccgaggaa       360
     cgcgacgacg acgacgatgc cgccgatccg tcgaccgccg cgcgcggctc gaagggaccg       420
     ggcggcggga ccgcgcgtcg gttcctcgag tggtgcgtgg acaagagaac caaatggctt       480
     ggtgccccgt acggagacca gggggtgtgg gtaaaacgac acgcgctcga tagcgtcggc       540
     ggcgtgcccc aacagtgctt catggaggac tacgagctcg taaagcggct gcgaagacgc       600
     cacgggatgc cgtgcgtcgt ggatgcggcc gtgaccacca gctcgcggcg gtgggacgcc       660
     atgggagtgg cgagagtcac agcgctgaac cagctcatag tgtttgggta cgccatgggc       720
     gtggcgcctg agaggctggc gaggtggtac acagctggca ggaacatggg tggcgggacc       780
     aagaggtggg acaccagggc ggaggcgaac gcggaggcga cgaaggtgga ggagcggtga       840
//

If you have problems or comments...

PBIL Back to PBIL home page