(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE351

MICSR_1.PE351        Location/Qualifiers
FT   CDS_pept        join(678958..680351,680392..680428)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636981"
FT                   /orf_name="MICPUN_56928"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61769.1"
FT                   /db_xref="UniParc:UPI000199A82F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M8"
FT                   /transl_table=1
FT                   /translation="MRLTCALLVMMFSVTRAVGASSVSSWAAVACPSRVVTKEDVGKPI
FT                   VLLGAWVRAGNGTDGSKDRHPSIASLRITSNPRHGALYWRAKPVLEGDAVPAEMGWERC
FT                   SEVSSRAFADAWPVGDPPLATPEWPCDVVVNANAPSPTHAAAAAAGVVVQPICAEVLYA
FT                   PDANYHNWPSGVDALGNRRVPGSNPTRDEAPDAFGFEFDLVAGDASAAGGAGGAADAMS
FT                   SSAASAASVLVAAVPDAPALTYTAAPIEDGDVAREGDRPALHAALLTRTRVRGIALRDV
FT                   DEGSFAVTVRIQSAVGNYVSVAGAGADVLARAVNPFRLGDGVMDAGVMEFTALPEDAAR
FT                   MLAALEYVHVVDDVYDERGYATDTVTVTATGGACLRSDDSFDDFSDAGEVTRCPRAADV
FT                   GATSVYVKVIVSGRVKDLGERSDPAWRRGFSSLLPIAASLAAATAWSAFAMWSGCAWAL
FT                   ERAGLGGAALGRRRARGA"
     atgaggctca cgtgcgcgct cctagtgatg atgttctcgg tcacgcgcgc tgtcggggcc        60
     tcttcagtgt catcgtgggc agcagtcgcg tgtccatcgc gcgtcgtcac gaaggaggat       120
     gtgggcaagc cgatcgtcct gctcggcgcg tgggtgcgcg ccggtaacgg caccgacggg       180
     tcgaaagatc gtcacccatc catcgcgtcg ctgaggataa cgtctaaccc gcgccacggc       240
     gcgctgtact ggcgcgcgaa gcccgtgctc gagggcgacg cggtgccagc cgagatgggt       300
     tgggagagat gctccgaagt gtcgtcgcgc gccttcgccg acgcctggcc ggtgggagac       360
     cctccgctcg cgacccccga atggccgtgc gacgtcgtcg tcaacgcaaa cgcaccctca       420
     cccacgcacg ccgccgccgc cgccgccggg gtggtcgttc agcccatctg cgccgaggtg       480
     ctctacgcgc cggacgcgaa ttatcacaac tggccgagcg gggtcgacgc gctgggcaat       540
     cgacgcgtcc cggggtcgaa cccgacgcgt gatgaagccc cggacgcgtt cggcttcgag       600
     ttcgaccttg tggccggtga cgcgtcggcc gcgggcggcg cgggcggcgc ggcggacgcg       660
     atgagctcgt ccgcggcgtc ggcggcgtcg gtgctcgtcg ccgccgttcc cgatgccccg       720
     gcgctgactt acacggctgc gccgatcgag gacggcgacg tcgcgcgtga gggcgaccga       780
     cccgcgctgc acgccgcgct cctgacccgc acgcgcgtcc gggggatcgc gctgcgtgac       840
     gtcgacgagg gttcgttcgc cgtgacggtt cgtatccaat ccgccgtcgg caactacgtc       900
     tccgtcgcgg gcgcgggcgc cgacgttctg gccagggccg tcaatccctt ccgtctcggc       960
     gacggggtca tggacgcggg ggtcatggag ttcacggcgt tgcccgagga cgccgcgcga      1020
     atgctcgccg cgctggagta cgtccacgtc gtcgacgatg tatacgacga gcgcgggtac      1080
     gcgacggaca cggtgacggt gacggcgacg ggcggcgcgt gcctccgctc ggacgattcg      1140
     ttcgacgatt tttccgacgc gggggaggtg acgcggtgcc ctcgcgccgc ggacgtgggc      1200
     gcgacgtcgg tgtacgtgaa agttatcgtg tcggggcggg tgaaggacct cggggagcgt      1260
     tccgatcccg cgtggcgtcg cggcttttcc tcgcttcttc caatcgccgc gtcgctggcg      1320
     gcggcgacgg cgtggtcggc gtttgcgatg tggtccgggt gcgcgtgggc gttggagcgc      1380
     gcggggttgg gtggggcggc gttgggacgg agacgcgcgc gaggcgcgtg a               1431
//

If you have problems or comments...

PBIL Back to PBIL home page