(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE352

MICSR_1.PE352        Location/Qualifiers
FT   CDS_pept        complement(<680971..>681759)
FT                   /codon_start=1
FT                   /gene_family="HOG000231240" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636982"
FT                   /orf_name="MICPUN_70072"
FT                   /product="Predicted protein"
FT                   /function="NAD+ binding"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds, in linear amides"
FT                   /function="zinc ion binding"
FT                   /biological_process="chromatin silencing"
FT                   /biological_process="protein deacetylation"
FT                   /protein_id="ACO62195.1"
FT                   /db_xref="GO:0006342"
FT                   /db_xref="GO:0006476"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016811"
FT                   /db_xref="GO:0070403"
FT                   /db_xref="HOGENOM:HBG596746"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="UniParc:UPI000199A830"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M9"
FT                   /transl_table=1
FT                   /translation="LEEREDPPEVMMEHVAVLVELIRQRGTFVMHTGAGFSTAAAIPDF
FT                   RGRDGIWTQQAKGRAVPMPRFENTKPTKAHLAAVALHDAGYLTHVVTQNVDGLHQRAGM
FT                   PQHAVSELHGSVFRELCRNEHCPMGPTPRDRTYHRAFDVTSTKRHNGRHRHRTGRRCDA
FT                   CGGDLHDVVVQFGEHLDDETLKTAIAASEASPLALVCGTSLKVPPASTLPRRSGALVVC
FT                   NLQWTSQDKHAALKIHARCDDVMLAVCGHLGIDVPEYDPSR"
     ctcgaggagc gcgaggatcc acccgaagtc atgatggagc acgtggcggt attggttgag        60
     ctgattcgtc agcgtgggac cttcgtcatg cacacgggag cggggttctc cacagcggcc       120
     gcgatccccg actttcgagg cagggacggc atatggacgc agcaggcgaa gggacgcgcg       180
     gtgcccatgc cgcggttcga gaacaccaaa ccgaccaagg cgcacctcgc cgcggtcgcg       240
     ctccacgacg ccgggtacct cacgcacgtc gtgacccaga acgtggacgg cttgcatcaa       300
     cgagcgggca tgccccaaca cgcggtgtcc gagctgcatg gctccgtgtt tcgcgagctg       360
     tgccggaacg aacactgccc gatgggcccg acgccccgcg accgtaccta tcaccgcgcg       420
     ttcgacgtca cctccaccaa gcgacacaac ggccggcaca ggcacaggac cggccgccgc       480
     tgcgacgcgt gcggcggcga cttgcacgac gtcgtcgtcc aattcggcga gcacctggac       540
     gacgagacgc ttaaaaccgc catcgccgcg tccgaggcgt cgcccctcgc cctcgtgtgc       600
     gggacgtcgc tcaaggtacc ccccgcgagc acgctgccac ggcgaagcgg cgcgctcgtc       660
     gtctgtaacc tgcagtggac cagccaggac aagcacgccg cgctcaagat tcacgcgagg       720
     tgcgacgacg tcatgctcgc cgtgtgcggg cacctcggaa tcgacgtgcc cgagtacgac       780
     ccgagcagg                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page