(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE353

MICSR_1.PE353        Location/Qualifiers
FT   CDS_pept        682105..682584
FT                   /codon_start=1
FT                   /gene_family="HOG000264683" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636983"
FT                   /orf_name="MICPUN_56930"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61770.1"
FT                   /db_xref="HOGENOM:HBG560157"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI000199A831"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N0"
FT                   /transl_table=1
FT                   /translation="MAGTTAEDEDRDRRPRKSPFQKLRREQRSLLCFVQALVGHLVVIE
FT                   TRDDVTTRGTLVEVDERMNCTLEGAQRVTVEQALEKKNSKFDRMFVRARLIRYVHVPAR
FT                   VDPAELIERRRQEEFDASRHYQAKVVFGPINPSPYDNSEEAQKIRAERAKGYAKH"
     atggcgggaa cgaccgcgga ggatgaggat cgggatcgac ggccgagaaa gtcgccgttc        60
     cagaagctca gacgcgagca gcggtcgctg ctgtgcttcg tacaggctct cgtggggcac       120
     ctcgtggtga ttgagacgag ggacgacgtg accacgcgcg ggaccttggt ggaggtggac       180
     gagcggatga actgcacgct cgagggcgcg cagcgggtga cggtggagca ggcgctggag       240
     aagaaaaaca gcaagttcga caggatgttc gtgagggcgc ggctcatacg ttacgtgcac       300
     gtccccgcgc gcgtcgatcc ggccgagctc atcgagcgca ggcggcagga ggagttcgac       360
     gcgtcgaggc actaccaggc caaggtggtg ttcgggccga tcaacccctc gccgtacgac       420
     aacagcgagg aggcgcagaa gatacgcgcg gagcgagcca aggggtacgc caagcattga       480
//

If you have problems or comments...

PBIL Back to PBIL home page