(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE355

MICSR_1.PE355        Location/Qualifiers
FT   CDS_pept        684953..685579
FT                   /codon_start=1
FT                   /gene_family="HOG000264685" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636985"
FT                   /orf_name="MICPUN_56932"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61771.1"
FT                   /db_xref="HOGENOM:HBG560158"
FT                   /db_xref="InterPro:IPR006917"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="UniParc:UPI000199A833"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N2"
FT                   /transl_table=1
FT                   /translation="MSASLRAAAPVARPRAPVRFRRRAPAVIRAATTADADSPPYQVAA
FT                   RKDLYELRIYGGHYVCRAPYNNREKGLAALMSYIEGGNEESKTFPATQPLIMRYECAPG
FT                   TEDVVGKTMELSLGAGVADPPASAEPEAVGVAAAGGELVAVVGFEGVATPELAGEYRRL
FT                   LTAAIRSDGLELAEPDGFRLATYGQLYSLKPRLNELMLKVKPPGA"
     atgtccgcct cccttcgcgc cgcggcgccc gtcgcgcgcc ctcgcgcgcc cgtgcgcttc        60
     cgccgccgcg ccccggcggt gatccgcgcc gcgacgaccg cggacgccga ctccccgccg       120
     taccaggttg ccgcccggaa ggatctgtac gagctgagga tctacggcgg tcactacgtg       180
     tgccgcgcgc cgtacaacaa ccgcgagaag ggcctcgccg cgctgatgag ctacatcgag       240
     gggggtaacg aggagtcgaa gacgttcccg gcgacccagc cgctgatcat gcggtacgag       300
     tgcgcgcccg gcacggagga cgtggtgggc aagacgatgg agctgtcgct cggcgcgggg       360
     gttgccgatc cccccgcgag cgcggagccc gaggccgtgg gggtggcggc cgcgggcggg       420
     gagctcgtgg cggtggtggg attcgagggc gtggcgacgc cggagctcgc gggggagtac       480
     aggaggctgc tgaccgcggc gatccgttcg gacgggctgg agctcgccga gccggatggg       540
     ttcaggctcg ccacgtacgg ccagctctac tccctgaagc cccggctcaa cgagctcatg       600
     ctcaaggtga agcccccggg ggcgtga                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page