(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE356

MICSR_1.PE356        Location/Qualifiers
FT   CDS_pept        complement(685629..686441)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636986"
FT                   /orf_name="MICPUN_99453"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO62197.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000199A834"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N3"
FT                   /transl_table=1
FT                   /translation="MEVPHSPHWSPLKDLTRISDAGATEDERTVHASVELKSTETEIKS
FT                   HRCPICYQTMLMPKRAPNILMPCGHTFCNACLNARDDPRCRTCGDRWRHRVPNHQLQTT
FT                   IQAYVDATATAAASFEDSVIWTSGDRGAPVASSSFDAALARAHVRCEQLRERMREGEAA
FT                   QTAALHREDVEARHLLVLQCDEDNARVRLAEVARELREAHAAVEAQRAVCAGIANEVRI
FT                   HGSSVRSAGEALAAVERGRERLVAEAEGSADGRTKPATLPGTHTAVSR"
     atggaggtgc cccactcgcc gcactggtca cctttgaagg accttactcg gatctcggac        60
     gccggcgcga ccgaggatga gcgcacggtc cacgctagcg tcgagctgaa gtcgacggaa       120
     actgagatca agtcgcaccg ctgcccgata tgctaccaaa ccatgctgat gccgaagagg       180
     gctccgaaca tcctcatgcc gtgcggtcat accttctgca acgcgtgcct caacgcgcgc       240
     gacgatccga ggtgtcgcac gtgcggcgac cgatggcgtc acagggttcc aaaccaccaa       300
     ctgcagacga cgatacaggc ctacgtcgac gcgacggcga cggcggcggc atccttcgag       360
     gactccgtca tttggacgag cggcgatcgc ggtgcgccgg tggcctcgtc ctcgttcgac       420
     gccgcgctgg cgcgcgcgca cgtgcggtgc gagcagctcc gggagcggat gcgggagggt       480
     gaggcggcgc agacggcggc gctgcaccgg gaggacgtag aggcgagaca cctgctggtg       540
     ctgcagtgcg acgaggacaa cgcgagggtg cgactggcgg aggttgcgcg agagctccgc       600
     gaggcccacg cggcggtgga ggcgcagcgg gcggtgtgtg cggggatcgc gaacgaggtt       660
     cggatacacg ggtcgtcggt gagaagcgcg ggggaggcgc tggcggcggt ggagcgggga       720
     cgggaacggc tggtagccga agcggaggga agcgcggatg ggaggaccaa gccggcgacg       780
     ctccccggga cgcacacagc tgtgtcgcgt taa                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page