(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE357

MICSR_1.PE357        Location/Qualifiers
FT   CDS_pept        686953..687696
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636987"
FT                   /orf_name="MICPUN_56934"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61772.1"
FT                   /db_xref="UniParc:UPI000199A835"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N4"
FT                   /transl_table=1
FT                   /translation="MVANKPGNLDGETAGSTVWTPPNELVVAAARARDAVAPSAERSAL
FT                   LKEKERQRSKRRRENATAEQRAKERARSARRRNALTPEEKQAQALKRAERRKERKANGT
FT                   LPAPKRAHRPLALAGSPERPLALRAAGEVDPATPGELGTFVEAVTAAAGAKATGAHIGK
FT                   GLTADDDAGDLRAVVPQIASATERRTPKKASTEEQRAAERNRSKMRRAAMTDEQRKKES
FT                   QARAERRRRSKALAAGGGGDGATAE"
     atggtcgcca acaagcccgg caacctcgac ggcgagaccg ccgggtccac ggtttggacg        60
     ccgcccaacg aactcgtcgt cgccgccgcc cgcgcgcgcg acgccgtcgc accgagcgcc       120
     gagcgatccg ccctgctcaa ggagaaggag cgccagcggt cgaagcgaag gagggagaac       180
     gccacggcgg agcagcgcgc caaggaacgg gcccgcagcg cccgccgacg caacgcgctc       240
     acccccgaag agaagcaggc gcaggccctg aagcgcgcgg agcggcgcaa ggagcgcaag       300
     gcgaacggaa cgctgcccgc ccccaagcga gcgcatcggc cgctcgcgct cgcgggctcg       360
     cccgagcggc cgctcgcgct gcgggccgcc ggggaggtcg atccggcgac gcccggcgag       420
     ctcgggacgt tcgtggaggc ggtcaccgcc gccgccggcg caaaggcgac cggcgcacac       480
     atcggcaagg gtttaaccgc ggacgacgac gccggggatc ttcgcgccgt cgtcccccaa       540
     atcgcatcgg cgacggaacg acggacgccc aagaaggcgt ctacggagga gcagcgcgcg       600
     gcggagagga accgatcgaa gatgcgacgg gcggcgatga ccgatgagca gcgcaagaag       660
     gagagccagg cgcgggcgga gcggcggagg cgatcgaagg cgctcgcggc gggcggcggc       720
     ggcgacggcg cgacggcgga gtga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page