(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE358

MICSR_1.PE358        Location/Qualifiers
FT   CDS_pept        join(688189..688287,688443..689825)
FT                   /codon_start=1
FT                   /gene_family="HOG000177308" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636988"
FT                   /orf_name="MICPUN_56935"
FT                   /product="Predicted protein"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /cellular_component="ubiquitin ligase complex"
FT                   /protein_id="ACO61773.1"
FT                   /db_xref="GO:0000151"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="HOGENOM:HBG315290"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013915"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199A836"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N5"
FT                   /transl_table=1
FT                   /translation="MFCSISGTTPEDPVISSKTGHLYERSLITKALQETGECPVTKTPM
FT                   TLEDLLPVKSSTTVKPRTTAAASIPGLLSIFHNEWDALMLETHELRVDLHGTRQELSHA
FT                   LYQHDAACRVISRLMKERDEAREALANARAAGPSAAPGKRAMSSDAMDVDGDAPGGDGK
FT                   KQRSGVPPEAIDAMTAKSKELSKARKKREISPTLASAEDIGKMEVGAIAPCHATKAKGI
FT                   RAVCVNPLNADEVATGGADGSLALFDAAKGKRGALMTGHKKAVTDVAYAGDAILTSSAD
FT                   KTVKIWRGGAEVAALAGVHEGEVVAVSAHPTNAYAVSIGGDGAWAFVDVGAAECLSVQR
FT                   DADSEYTCGGFHPDGLILGTGAADSSVKIWDVKTSKVAAKVEGHVGAVSAMSFSENGYY
FT                   LATCANDGVKLWDLRKLKNFKSVEAAGVRCVRFDHSGHYLAVGGADACVHNVKAEWEVV
FT                   KRWEASKAPVNALEFAADAKALYAGCSDHNLRVIA"
     atgttctgct cgatctcggg cacgacgccc gaggacccgg tcatctcctc gaagactggg        60
     cacctctacg agcggtccct catcaccaag gctctccagg agaccggcga gtgcccggtg       120
     accaagaccc cgatgaccct cgaggacttg ctccccgtca agtcgagcac gacggttaaa       180
     ccccgaacca ccgccgccgc gtccatcccc gggctcctct ccatcttcca caacgagtgg       240
     gacgcgctca tgctcgagac gcacgaactc cgcgtcgacc ttcacggcac caggcaggaa       300
     ctctcgcacg cgctgtacca gcacgacgcc gcgtgccgcg tcatctccag gctcatgaag       360
     gagcgcgacg aggcgcgcga ggccctcgcg aacgcgcgcg cggctggtcc ctccgccgcc       420
     cccggcaagc gagccatgtc atctgacgcc atggacgtcg acggcgacgc gcccggcggc       480
     gacggcaaga agcaaagaag cggcgtcccg cccgaggcga tcgacgcgat gaccgccaag       540
     agcaaggaac tgagcaaggc gcgtaagaag cgcgagatct ctcccaccct cgcctccgcc       600
     gaagacatcg gcaagatgga ggttggcgcc atcgcgccgt gccacgcgac caaggcgaag       660
     ggcatccgcg ccgtttgcgt caaccccttg aacgccgacg aggtggcgac gggcggcgcc       720
     gacggatcgc tcgcgctctt cgacgccgcc aagggcaagc gcggcgccct catgaccggt       780
     cacaagaagg ccgtgaccga cgtcgcctac gccggcgacg ccatcctcac gtcatccgcg       840
     gacaagacgg tcaagatttg gcgcggcggc gccgaggtcg ccgcgctcgc gggggtccac       900
     gagggcgagg tcgtcgccgt cagcgcgcac cccacgaacg cgtacgcggt gtccatcggc       960
     ggcgacggcg cgtgggcgtt cgtggacgtc ggcgcggcgg agtgcctcag cgttcagcgc      1020
     gacgcggatt ccgagtacac gtgcggcggc tttcaccccg acggtctcat cttgggcacg      1080
     ggcgccgccg actcgagcgt caagatctgg gacgtcaaga cctccaaggt ggccgccaag      1140
     gtggagggcc acgtcggtgc ggtgagcgcc atgtcgttct ccgagaatgg gtactacctc      1200
     gcgacgtgcg cgaacgacgg cgtgaagctc tgggacttga ggaagctgaa gaactttaag      1260
     agcgtcgagg cggcgggcgt gcggtgcgtg cggttcgacc acagcggtca ctacctggcc      1320
     gtgggcggcg ccgacgcgtg cgtgcacaac gtcaaggcgg agtgggaggt ggtgaagagg      1380
     tgggaggcga gcaaggcgcc ggtgaacgct ctggagtttg cggcggatgc caaggcgctc      1440
     tacgcgggct gcagcgacca caacctcagg gtcattgcgt ga                         1482
//

If you have problems or comments...

PBIL Back to PBIL home page