(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE359

MICSR_1.PE359        Location/Qualifiers
FT   CDS_pept        join(complement(692259..692339),complement(690471..692117))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636989"
FT                   /orf_name="MICPUN_99456"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO62198.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199A837"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N6"
FT                   /transl_table=1
FT                   /translation="MTTDGDPRGLPNSHVEGISEGQILSMEGDELAAHDNLEEALDRYD
FT                   RALLADRKQHGDTHPDVAARYCSIGGLYKATGDNEMAREYFAKALEVEESTGTDGRRTA
FT                   RASYMSNLAAVSRAAGDVDLARDQYCTALDHLRGMIPDSNEAVETALSREEASLFRVSG
FT                   DTSTSGYGIGGEGVAAPSPKLLGEGGVLNVAASILNNLGLLLKSIGRLHAARRCYVRAI
FT                   SLGAVALGAHSPAIALRVRNLGAVLLQLGYVDLAVERLTRAHGACVLGHGADHPETIMC
FT                   AEWLQAATETADLDAHAHAHARGVGSDPDETLPEAAEWFCERLRCGVLEPTPEPSLPGE
FT                   ERAIEAIDPAPIGLEDAMVPAVEHATRDAEAAGVGHSHAGTGKTFGVGTPGLDASESQT
FT                   RFNPVEPPPGEDMLSPYAAPVTSRELKRVGNAETSPVWRAVALEHEAIVSGKSSMPRGQ
FT                   DYISAYLRQAPGYANLITPFQEMPSDLLMPYASFRGYGAPLKSGAARQGKGEPRRHQLP
FT                   KRTLDERGVASSAGTAPRPRAIEVREEEEETTPVAQVGLGGRAGESRSGGRNMYAYPD"
     atgaccacgg atggagaccc tcgcgggtta ccgaacagtc acgtggaagg gataagcgag        60
     ggccagatcc tgagcatgga gggagacgag ctcgccgctc acgacaatct cgaggaggcg       120
     ctcgacaggt acgaccgcgc gctgctcgcc gaccgcaaac agcacggcga cacgcaccca       180
     gacgtcgctg ccaggtactg cagcatcgga gggctgtaca aagccacggg cgataacgag       240
     atggcgcgcg agtacttcgc caaggcgctc gaggtggagg agtccacggg caccgacggg       300
     aggcggaccg cgagggcgtc gtacatgtcg aacctcgcgg cggtatcgcg cgctgccggg       360
     gacgtggacc tcgcgagaga tcagtactgc acggcgctgg accacctccg ggggatgata       420
     cccgactcca acgaggcggt cgagacggcg ctgtcgaggg aggaagccag tctgtttcgc       480
     gtcagcggcg acacgtcgac gtcggggtac ggcatcggcg gcgagggcgt cgcggcgccg       540
     tctccgaagc tcttgggcga gggcggcgtc ctgaacgtcg ccgcgtcgat cctgaacaat       600
     ctcggcctgc tgctcaagtc gatcggccgg ctgcacgccg cgcggcgttg ctacgtccgc       660
     gccatctccc tcggcgccgt cgcgctcggc gcgcactcgc ccgccatcgc gctgcgcgtg       720
     cgtaacctcg gcgccgtctt actgcagctc gggtacgtag atttggcggt ggagcgcctg       780
     acccgcgcgc acggggcttg cgtcttgggg catggcgcgg accatcccga gacgatcatg       840
     tgcgcggagt ggctccaggc ggcgacggag acggctgacc tggacgcaca cgcgcacgcg       900
     cacgcgcggg gggtggggtc cgacccggac gagaccttgc cggaggcggc ggagtggttc       960
     tgcgagcggc ttcgatgcgg cgtgctcgag ccgacgccgg agccgagtct gcccggggag      1020
     gagcgcgcca tcgaggcgat cgatccggcg ccgatcggcc tggaggacgc gatggtaccc      1080
     gcggtggagc acgcgacccg tgacgcggag gcggcggggg tgggacattc acacgcgggg      1140
     actgggaaga cgttcggcgt tggcacgccg gggttggacg catcggaaag ccagacgagg      1200
     tttaaccccg tggagccgcc ccccggcgag gacatgctca gcccgtacgc cgcgcccgtc      1260
     acgtcgcggg aactcaagcg cgtgggtaac gcggagacct cgccggtgtg gcgcgcggtc      1320
     gcgctggagc acgaggcgat cgtctccggc aagagctcca tgccccgagg tcaggattac      1380
     atcagcgcgt atcttcgaca ggcgcccggg tacgcgaacc tcatcacgcc gttccaggag      1440
     atgccctcgg acctcttgat gccgtacgcg tcgttccggg gctacggcgc cccgctgaag      1500
     agcggagcgg cgcggcaagg gaaaggggag ccccggcggc accagctccc caagaggact      1560
     ctggacgagc gaggagtggc gtcgagcgcg gggacggcgc cgaggccgag ggccatcgag      1620
     gtgagagagg aggaggagga gacgacgccg gtggctcagg tggggttggg gggcagggcg      1680
     ggtgaatctc gcagcggcgg gaggaacatg tacgcgtacc cggattga                   1728
//

If you have problems or comments...

PBIL Back to PBIL home page