(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE36

MICSR_1.PE36         Location/Qualifiers
FT   CDS_pept        join(complement(64692..64727),complement(63593..64510))
FT                   /codon_start=1
FT                   /gene_family="HOG000231322" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636041"
FT                   /orf_name="MICPUN_56609"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62047.1"
FT                   /db_xref="HOGENOM:HBG525604"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000199AB2C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R3"
FT                   /transl_table=1
FT                   /translation="MRPILLKGHERCYNKEGDLLFTCAKDHHPTLWYSDDGERVGTYIG
FT                   HNGAVWTCDVTEDSKTLVTGSADTTCKMWDTETGTCYFTHQFEQPVRAVALSKGDQHMV
FT                   ISSDPFMGVPAALHIVDVAANREEQTNEIKISMSGPEGRINRALWGPLNRTILTGGEDG
FT                   VIRLWDVETGKIVHEANDHKKQIQHLSLSVDKTHFISASLDKTAKLFDSETLECLKTYA
FT                   ADRPVNAAILSPILDHIILGGGQDAMAVTTTHSKAGKFDSKIFYKIYEEEIGGIRGHFG
FT                   PINALAWHPDGRSFTSGGEDGYVRIHHFDNDYFRIK"
     atgcgtccca tcctgctcaa gggccatgag aggtgctaca acaaggaggg cgacctcctg        60
     ttcacgtgcg ccaaggatca ccaccccacg ctgtggtact ccgacgacgg cgagcgcgtt       120
     ggcacgtaca tcggccacaa cggcgccgtg tggacgtgcg acgtgaccga ggactccaag       180
     accctcgtca ccggttccgc ggacaccacg tgcaagatgt gggacaccga gaccgggacg       240
     tgctacttca cccaccagtt cgagcagccc gtccgcgcgg tggcgctctc caagggcgac       300
     cagcacatgg tgatatcgtc cgatcccttc atgggcgtcc cggccgcgct tcacatcgtg       360
     gacgtcgcgg cgaacaggga ggagcagacg aacgagatca agatttcgat gtccgggccg       420
     gaggggagga tcaacagggc gctgtggggc ccgctgaacc gcaccatcct cacgggcggc       480
     gaggacggcg tcatccgcct gtgggacgtg gagactggga agattgtgca cgaggcgaac       540
     gaccacaaga agcagatcca gcacctctcg ctctccgtcg acaagacgca cttcatcagc       600
     gcgtccctgg acaagaccgc gaagctcttc gactccgaaa ccctggagtg cctcaagacg       660
     tacgcggcgg atcgaccggt gaacgccgcc atcctctcgc cgatcctcga ccacatcatc       720
     ctgggtggtg gccaggacgc gatggcggtg accacgaccc actccaaggc tggcaagttc       780
     gactccaaga tcttctacaa gatctacgag gaggagatcg gcgggatccg cgggcacttc       840
     gggcccatca acgcgctcgc gtggcacccg gatggccgct cgttcacgtc gggtggcgag       900
     gacggctacg tccgcatcca ccactttgac aacgactact tccgcatcaa gtaa             954
//

If you have problems or comments...

PBIL Back to PBIL home page