(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE361

MICSR_1.PE361        Location/Qualifiers
FT   CDS_pept        complement(695284..696183)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636991"
FT                   /orf_name="MICPUN_99458"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62199.1"
FT                   /db_xref="UniParc:UPI000199A8A9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N8"
FT                   /transl_table=1
FT                   /translation="MAPEKEPLEPSWLAQVKELLGPHKRYHRAQTEDALPSGVKVEQAS
FT                   RFPKEVAHFTRWKIIHIECSRWDADAMMKRAEVHVVDLVDAATIKLNPALHSHALELEA
FT                   ADDGLVVSNRGGFHSKPDAVQKLSDCGCEEATQIMNLVRSCVMYEPGKKARHENDAKVT
FT                   TAWINVCRNGHTHGLHSHEPAKFSAVYYVSVPESKEEEEEEEDSLSGHLVLRFGSGGNE
FT                   GDPALGLEDDSWCLWDHVEPKEGRLVIFPSSMPHGVLKVSTAADEEKPRISIAFNTGEK
FT                   NVNLEKYGKKNKKRKKTE"
     atggcaccgg agaaggagcc gctggagccg tcgtggctcg cgcaggtgaa agagctcctg        60
     ggtccgcaca aacggtacca tcgcgctcaa accgaagatg cactcccgag cggcgtaaag       120
     gtggagcagg cttctcgctt tccgaaagag gttgcgcact tcacgcgctg gaagatcatt       180
     cacatagagt gctctcggtg ggacgccgat gcgatgatga aaagagctga ggtgcacgtc       240
     gtcgacctcg tcgacgccgc gactatcaaa ctaaacccag ctttgcactc ccacgcgctg       300
     gagctggagg ctgccgacga cggactggtg gtgagtaacc gcgggggctt ccactccaag       360
     ccagacgcag tccaaaaact atccgactgc ggatgcgagg aggcgacgca gataatgaac       420
     ctcgtgcgat cgtgcgtgat gtacgaaccg ggtaaaaagg cgagacacga aaatgacgcc       480
     aaggtgacca ctgcgtggat caacgtgtgc cgcaacggcc acacacacgg cctgcacagt       540
     cacgagcccg ctaagttctc cgccgtgtat tacgtctcag tgccggagtc gaaggaggag       600
     gaggaggagg aggaggattc cttgtccggt catctcgtgc tgagattcgg atcaggaggt       660
     aacgagggtg accctgcttt ggggctggag gacgacagtt ggtgcctgtg ggaccacgtg       720
     gagccgaagg agggtcggct cgtgatattt ccctcctcga tgccgcacgg cgttttgaaa       780
     gtgtcgaccg cggcggacga agagaaaccg aggatatcca tcgcgttcaa cacgggcgag       840
     aagaacgtga acctcgaaaa gtatggaaag aagaacaaga agcggaagaa gacagagtag       900
//

If you have problems or comments...

PBIL Back to PBIL home page