(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE362

MICSR_1.PE362        Location/Qualifiers
FT   CDS_pept        696428..697309
FT                   /codon_start=1
FT                   /gene_family="HOG000264703" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636992"
FT                   /orf_name="MICPUN_56939"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO61775.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG560164"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR016118"
FT                   /db_xref="UniParc:UPI000199A8AA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N9"
FT                   /transl_table=1
FT                   /translation="MKTGPPAWAVDASIVFALVYLAGSLELVEPFERYLVPETLPKYSY
FT                   PFTTDQSVPTWTLPFLGVFIPLGLIVSVAAFTGAGWLEIRRSIAGLCVSVSLGWAVTNL
FT                   LKVSIGGYRPDFLYRCWPDGNVAWASPGVPACTPTNPRHVIEGRKSFPSGHSSMSFSGL
FT                   AYAAAYATARLEVFSPYDYGVVGVHPRDRASMLRMALAWWPLALATYVALSRWRDYWHH
FT                   SEDVICGSLLGTGAAYLAWVTKQPLAGAGARGAGGLRREGRDYAPIGAESGEGSADSAR
FT                   LDRMEGRGPRSE"
     atgaagacgg gtcctcccgc atgggcggtg gatgcgtcca tcgtcttcgc gctcgtctac        60
     ctcgccggct ccttggaact cgtcgaaccg tttgagcggt acctggtccc ggagacgctc       120
     ccaaaatatt cgtacccgtt cacgacggac cagagcgtcc cgacgtggac gctcccgttc       180
     ctcggcgtgt tcatcccgct cggtttgatc gtatccgtcg cggctttcac cggcgcgggt       240
     tggctggaga tccggaggtc catcgcgggt ctgtgcgttt ccgtgtcact gggttgggcc       300
     gtgacgaatc ttctcaaggt atccatcggt gggtacaggc ccgacttcct ctaccgctgc       360
     tggcccgacg gcaacgtcgc gtgggcctcg ccgggggtcc cggcgtgcac gcccacaaac       420
     cctcggcacg tcatcgaagg caggaaatcg tttcccagcg gacactccag catgtcgttt       480
     tcgggtctcg cctacgcggc ggcgtacgcc acggctaggc tggaggtctt ctccccgtac       540
     gactacggcg tcgtcggcgt gcacccgaga gaccgggcgt caatgttaag gatggcgttg       600
     gcgtggtggc cgctggcgct cgcgacgtac gtggcgttga gcaggtggag ggattactgg       660
     caccactccg aggatgtgat ttgcgggtcg ctgctcggga cgggcgcggc gtacttggcg       720
     tgggtgacta agcagccctt agccggcgcg ggagctcgcg gcgccggggg tttgcgcagg       780
     gaggggcgag attacgcgcc gattggggcg gagagcggcg aagggagcgc ggattcggct       840
     cggttggaca ggatggaggg gcggggtccg cgctcggagt aa                          882
//

If you have problems or comments...

PBIL Back to PBIL home page