(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE363

MICSR_1.PE363        Location/Qualifiers
FT   CDS_pept        complement(697428..699731)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636993"
FT                   /orf_name="MICPUN_99459"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62200.1"
FT                   /db_xref="UniParc:UPI000199A8AB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P0"
FT                   /transl_table=1
FT                   /translation="MSDPEDEEPAMEEEEEEELEVEEGDEEQFEEGEEGEELEEGEEGE
FT                   MEEGEEGEEDLEEGEEEPEEEPEEGEYEEEDDGDVADEFSEERPDASPEGRKSKSSKGG
FT                   RSSKGPDPEYPTEPESDSDDDALSRRRRKNKLSKAARDPYRFVRDSDDESISSGRDRRG
FT                   GEPWRTKMDGKTEYNTLANEVRNYSMHRPPGPDGRAHRMEDLPVKLAFEHLSSLAGMSE
FT                   KVQNAINLSRNLFQRRVDKMEKGVMFKAWRGWLLVQHDFNNKRNILTRAVNKMKRRRLY
FT                   KAFSKWAELHNKAHRPSHFDKAARAVVLGGCRRRTFGAWREHTKDVRRQFKMAAHTARM
FT                   REEFLERLVEAGLRQVMHKRIRRAWDAFDKFSEVRRAKRNKARQVIGRAMNREQARAFG
FT                   RWREYVAQLNKQHGQLKRAVARMSKATMARAFDAWQGQQLHKKRCLMKIIKGTQARAFA
FT                   KWQDNLRLLRKARIVFARWNQRTRYAAFNGWWLNVEEKRRQTEMCSKICKRILNRAVRN
FT                   AWAQWMYCVEQSFGCTLEQVKALRDQNARLRRDNERFVRLVDSGEWGRGRVEELSEAGR
FT                   LLRDERKQLEDLIRSIKDEKDGFVKDAELQAREARALKDRLVSGNFVQRNKLNVRGGSA
FT                   FNSMQRVLKQDLIDSGAAARQRHMLGGAVHNVDRLAMDKVSVFADGEIQMQAVKRAPPP
FT                   FARGGARRPAPPPLRAAPPPVPMPRTTAPRPASAPRDEEGENVLVEALSSLTADEVDAL
FT                   EDILKRGRTDAALV"
     atgtccgacc cggaagatga ggaacccgcg atggaggagg aggaggagga ggagctcgag        60
     gtggaggagg gcgacgagga acagttcgag gagggagagg agggagagga gctcgaagaa       120
     ggcgaagagg gcgagatgga agagggcgaa gaaggcgagg aggatctcga ggaaggcgag       180
     gaggaacccg aggaggaacc cgaggagggc gaatacgagg aggaggacga cggcgacgtc       240
     gcggacgagt tcagcgagga acgtccggac gcctcacccg agggtcggaa gagcaaatcg       300
     tccaagggcg gtaggtcctc caagggaccc gatcccgagt accccaccga accggaatcc       360
     gactcggacg acgacgcgct ctccaggcgc aggcgcaaga acaagctgag caaggcggcg       420
     agggacccgt acaggttcgt ccgcgacagc gacgacgagt ccatcagctc gggccgcgac       480
     cggaggggcg gcgagccctg gcgcaccaag atggacggca agacggagta caacactctc       540
     gccaacgagg tgaggaatta ctccatgcac aggcccccgg gtcccgacgg gcgagcgcac       600
     aggatggagg acctgccggt gaagctcgcg ttcgagcacc tctcctcgct cgcgggcatg       660
     agcgaaaaag ttcagaacgc gatcaacctg agccgcaacc tgttccagcg ccgcgtcgac       720
     aagatggaga agggcgtcat gttcaaggcg tggcgcggct ggctcctggt gcagcacgac       780
     ttcaacaaca agcgcaacat cctgacccgc gcggtgaaca agatgaagag acgcaggctg       840
     tacaaggcgt tctccaagtg ggccgagctg cacaacaagg cgcatcgacc ctcgcacttt       900
     gacaaagccg cgcgggcggt ggtcctcggc gggtgcagac ggaggacctt tggcgcgtgg       960
     cgcgagcaca ccaaggacgt caggcgccag tttaagatgg cggcacacac cgcgcggatg      1020
     cgcgaggagt tcctcgagag gctggtggag gctggcctga ggcaggtcat gcacaagcgc      1080
     atccgccgag cgtgggatgc ctttgacaag ttcagcgagg tgcgccgcgc caagcgcaac      1140
     aaggcgcgac aagtgattgg ccgcgccatg aacagggagc aggccagggc atttggccgg      1200
     tggagagagt acgtagcgca gctcaacaag cagcacgggc agctcaagcg cgccgtggcg      1260
     cgcatgtcca aggcgacaat ggctcgcgcc tttgacgcct ggcagggcca gcaactgcac      1320
     aagaagcgat gcctgatgaa gatcatcaag ggcacgcagg ccagggcgtt cgccaagtgg      1380
     caggacaacc tgcgcttgct gcgcaaggcc aggatcgtgt ttgcgcgatg gaaccagcgc      1440
     acgcgctacg cggcgtttaa tggatggtgg ctcaacgtcg aggagaagcg gcggcagacg      1500
     gagatgtgct ccaagatttg caagcgcatc ctcaaccgcg ccgtgcgcaa cgcgtgggcg      1560
     cagtggatgt actgcgtgga gcagagcttc gggtgcacgc tggagcaggt caaggctctg      1620
     cgcgatcaga acgccaggct tcgccgcgat aacgagcggt tcgtgcggct cgtggattcc      1680
     ggcgagtggg gtcgcggtcg ggtcgaggag ctctccgaag ccggccgcct gctcagggac      1740
     gagcgcaagc agctcgagga tctcatcagg agcatcaagg atgagaagga cggcttcgtc      1800
     aaggatgccg aacttcaggc gagggaggcg agggcgctca aggacaggct cgtcagcggc      1860
     aactttgtcc aacgaaacaa gctgaacgtc cgcggcggat cggctttcaa ctccatgcag      1920
     cgggttttga agcaggacct catcgacagc ggcgccgcgg ccaggcagcg tcacatgctc      1980
     ggaggtgccg tgcacaacgt tgaccgcctc gcgatggaca aggtttccgt ttttgccgac      2040
     ggagagatcc agatgcaggc tgtcaagagg gcgccgccgc cgtttgccag gggcggcgcg      2100
     aggaggccag cgccgccgcc gctgagggcc gctccgccgc ccgtcccgat gccgcggacg      2160
     acggcgccgc gaccggcgag cgcgccaagg gacgaagagg gggagaacgt gttggtggag      2220
     gcgctgtcga gtctcaccgc cgacgaggtg gatgcgctgg aggacattct gaagcggggc      2280
     aggaccgacg ccgctttggt ctaa                                             2304
//

If you have problems or comments...

PBIL Back to PBIL home page