(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE364

MICSR_1.PE364        Location/Qualifiers
FT   CDS_pept        complement(701033..702871)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636994"
FT                   /orf_name="MICPUN_52217"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62201.1"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniParc:UPI000199A8AC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P1"
FT                   /transl_table=1
FT                   /translation="MSRKYEPDAVADTPAAASWTHALAGYDETLRSRGSTFRLTFPLDQ
FT                   FKRPIHDPRSTSRATALASAAWYLGVFAFAAFAVYAHVTRPTVTNLVLLPSTALPPLPL
FT                   TLRTRCSSPWACTPGATPLPGATHIGPCRYENPYNRTYACAKHAHNILDGPELDANGAE
FT                   VWPNLTDTPTSAGAGGRRRLLNDHLWTWTRAATATQAYKSPTSRCDAERVATVTSWGAE
FT                   ASALDLTDADPRVYAGFDPDAMARRARDPNAAVDELFAALDEDASGFLDGAELDVLGPF
FT                   ARIMLKLNNFGDYHEGNATFAGGFKDIEDFTGPGSTTGVIERGVVDEMRTYLAGFGYEC
FT                   TWCVTVDDYRNALRYVWDSTKANWNGFVANVDPLYHPWSYVLSGDAFYPTTSVGVDAFP
FT                   KDGRVSPAELREAFRYMLAHQTVTPWAVAQAVSAALDANPDAAESAAMQLCSADVAAGD
FT                   DALGGILVETTFPPGCPYGSESCDTRLTIELGDGKANGMALRLDLEPGQRKAVQVGVTV
FT                   RRERGKPDAYELRADDLFYVGKNDDRRASLRVGVKQYAEALDTARPGTWLTVFAAVGGF
FT                   ASLSLSILSLGVGAIAALAERSESACACLGDAFGRG"
     atgtcgcgta agtacgagcc cgacgcggtg gcggacaccc ccgccgccgc ctcctggacg        60
     cacgccctgg ctgggtacga cgagacgctt cgttctcgcg gctcgacgtt ccgtctgacg       120
     tttccgctcg atcagttcaa gcgccccatc cacgatcctc ggtcgacgtc tcgcgccacc       180
     gcgctcgcgt ccgcggcgtg gtacctgggc gtgttcgcct tcgcggcgtt cgccgtctac       240
     gcgcacgtca cgcgcccgac cgtgacgaac ctggtcctcc tgccctcgac cgcgctcccc       300
     ccgctcccgc tcacgcttcg cacgcgatgc tcctccccgt gggcgtgcac gccgggcgcg       360
     acgccgctcc ccggcgcgac gcacatcggc ccgtgccggt acgagaaccc ctacaaccgc       420
     acgtacgcgt gcgcgaagca cgcgcacaac atcctggacg gccccgagct cgacgcgaac       480
     ggcgccgagg tctggcccaa cctcaccgac acccccacga gcgccggcgc cggcggacgc       540
     cgacgtctcc tcaacgacca cctgtggacg tggacgcgcg cggcgacggc gacgcaggcg       600
     tacaagtccc ccacctcgcg gtgcgacgcc gagcgcgtcg ccacggtcac gagctggggc       660
     gcggaggcga gcgccctgga cctcacagac gccgacccgc gcgtgtacgc cggcttcgac       720
     cccgacgcga tggcgcgccg cgcccgggat ccgaacgccg cggtggacga gctcttcgcc       780
     gcgctcgacg aggacgcgtc gggcttcctc gacggcgccg agctggacgt cctcggtccg       840
     ttcgcgagga tcatgctcaa gctgaataac ttcggggact accacgaggg gaacgcgacg       900
     ttcgcgggcg ggttcaagga catcgaggat ttcaccgggc ccgggtcgac gacgggcgtg       960
     atcgagcggg gggtggtgga cgagatgcgg acgtacttgg ccgggttcgg gtacgagtgc      1020
     acgtggtgcg tcacggtgga cgactacagg aacgccctgc gatacgtctg ggactcgacc      1080
     aaggcgaact ggaacgggtt cgtcgcgaac gtcgacccgc tgtaccaccc gtggagctac      1140
     gtcttatccg gcgacgcgtt ttacccgacg acgagcgtcg gcgtggacgc gttcccgaag      1200
     gacgggcgcg tgtcccccgc ggagctccgc gaggcgtttc ggtacatgct cgcgcaccag      1260
     acggtcaccc cgtgggcggt ggcgcaggcg gtgagcgcgg cgctggacgc gaaccccgac      1320
     gcggcggagt ccgcggcgat gcagctgtgc agcgcggacg tcgccgcggg agacgacgcg      1380
     ctgggcggga tcctggtcga gacgacgttc cccccggggt gcccgtacgg atcggagagc      1440
     tgcgacacgc ggctgacgat cgagctcggc gacgggaagg cgaacgggat ggcgctccga      1500
     ttagacctcg agccggggca gaggaaggcg gtgcaggtgg gggtgacggt gcggcgggag      1560
     cgggggaagc cggacgcgta cgagcttcgc gcggacgatc tcttctacgt cgggaagaac      1620
     gacgaccgga gggcgagtct ccgcgtcggg gtgaagcagt acgccgaggc gctcgacacg      1680
     gccaggccgg ggacgtggct caccgtgttc gccgccgtcg gggggttcgc gagcctgtcg      1740
     ctctcgatcc tctcgctggg ggtcggggcg atcgccgccc tcgcggagag gagcgagtcc      1800
     gcgtgcgcgt gcctcggcga cgccttcggg aggggatga                             1839
//

If you have problems or comments...

PBIL Back to PBIL home page