(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE365

MICSR_1.PE365        Location/Qualifiers
FT   CDS_pept        703032..703430
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636995"
FT                   /orf_name="MICPUN_56942"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61776.1"
FT                   /db_xref="UniParc:UPI000199A8AD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P2"
FT                   /transl_table=1
FT                   /translation="MNGDDILLKPSAETMSRSTTGDVMPQTEARAYALSLPPAQRSEIS
FT                   GCYCLKCVPCGSFPVAAHCVCGGSSLCWGCGTTPFACFAIPMPFIDPYFRSIKRDCVVM
FT                   VVNAEDQTLACYPGEQAEDPICIWSKLW"
     atgaacggcg atgatatctt acttaagccg agtgccgaga cgatgtcccg cagcaccacg        60
     ggagacgtga tgccgcaaac cgaagcgcgg gcgtacgccc tttcgcttcc tcccgcgcag       120
     agaagcgaga tcagcggatg ctactgcctg aaatgcgtcc cttgcgggtc gtttcccgtc       180
     gcggcgcact gcgtttgcgg cggttcttcg ctttgctggg ggtgtggaac gactcccttc       240
     gcgtgcttcg cgatcccgat gcctttcata gacccatact tcaggagcat caagcgagac       300
     tgcgttgtga tggtcgtcaa cgcggaggac caaactctgg cgtgctaccc cggtgaacaa       360
     gccgaggatc ccatctgcat ttggtcaaag ctgtggtga                              399
//

If you have problems or comments...

PBIL Back to PBIL home page