(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE367

MICSR_1.PE367        Location/Qualifiers
FT   CDS_pept        join(705048..705256,705359..705587,705834..>706004)
FT                   /codon_start=1
FT                   /gene_family="HOG000003584" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636997"
FT                   /orf_name="MICPUN_80272"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO61777.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG706903"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000199A8AF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P4"
FT                   /transl_table=1
FT                   /translation="MLREKADMGDPKAMSDLGATYFQGDELPRDHSTAFAWFERSATAG
FT                   YTLAFVNLATCYREGLGCPKDERKAEGAYWFRRGAEAGSLECSYRWGVCCATGTGAERD
FT                   FGNAAEAFRFAAERGHAGAALDLGHCLMNGLGIIGGAKKSMAAWYERAVALGVTDAAAA
FT                   LGRMHRDGVGGDETTRDLDEASKWFRISAAGGDDASAQAL"
     atgctgcgcg agaaggccga tatgggggac ccgaaggcga tgagcgacct gggcgccact        60
     tacttccagg gcgacgagct tccccgcgat cactccaccg ccttcgcgtg gttcgaacga       120
     tcggcgaccg ccggttacac cctcgcgttc gtcaacctgg ccacctgcta ccgcgagggg       180
     ctcggctgcc cgaaggacga gcggaaggcg gagggtgcgt actggtttcg acgcggcgcg       240
     gaagccgggt cgctggagtg ctcgtaccgg tggggcgtct gctgcgccac gggcaccggc       300
     gcggagaggg acttcggaaa cgcggccgag gcgttcaggt tcgccgccga gcgcgggcac       360
     gcgggcgccg ccctcgacct cggccactgc ctcatgaacg gcctcggcat cataggcggc       420
     gcgaagaagt ccatggcggc gtggtacgag agagcggtgg cactcggcgt cacggacgcg       480
     gcggcggcgt tgggtcgcat gcacagggac ggcgtgggcg gggatgagac gacgcgtgat       540
     ttggacgagg cgtccaaatg gttccgaatc tccgccgccg ggggcgacga cgcttcggct       600
     caggcgctc                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page