(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE368

MICSR_1.PE368        Location/Qualifiers
FT   CDS_pept        join(complement(708218..708724),complement(707003..708115))
FT                   /codon_start=1
FT                   /gene_family="HOG000021559" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636998"
FT                   /orf_name="MICPUN_56945"
FT                   /product="Pyruvate kinase"
FT                   /function="magnesium ion binding"
FT                   /function="potassium ion binding"
FT                   /function="pyruvate kinase activity"
FT                   /biological_process="glycolysis"
FT                   /protein_id="ACO62203.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004743"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0030955"
FT                   /db_xref="HOGENOM:HBG734376"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015794"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="UniParc:UPI000199A8B0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P5"
FT                   /transl_table=1
FT                   /translation="MANIQVDDILAGTPAVQCKTKVRAPSAPTTRDPPARFLTRLANYG
FT                   IPLAPEQIVCTLGPKSAELSIMEDLLRAGMSVARFNFSHGSHEYHQGTLNTLRQAMLNT
FT                   RLMCAVLLDTKGPEIRTGMLKGGKPVLMEAGREVTIHTDYTLHGDEHNIAMSYKKLPND
FT                   VAPGAEILIGDGSIVMVVLSCHPENGTVRCRCANTAMLGERKNVNLPGVVVDLPTITEK
FT                   DRDDILGWGVPNGIDFIAASFVRKGSDVRYIREVLGEEGKSIKIISKVENQEGLVNFDD
FT                   ILEESDGVMVARGDLGMEIPTEKIFLAQKLMIEKCNAAGKPVVTATQMLESMVKNPRPT
FT                   RAEATDVANAVLDGTDCVMLSGETAAGAFPVDAVRVMSKICREAEVSIDHYQLFKSILA
FT                   QVPIPMQPLESLASSAVRTAQKVRAALIVVLTHGGSTARLVAKYRPAVPVLTVFVPTLT
FT                   TDSLTWQCSGESPARQANLTRGLIPLLAEGSARATDTDTTDEILHAAIDHAKAAGYCAS
FT                   GECIVALHRIGNASVIKIVNIP"
     atggcgaaca tccaggtgga cgatatcctc gcggggacac ccgcggtgca gtgcaagacc        60
     aaggtgcgcg ccccttccgc cccgacgacc cgcgatccgc ccgctcgatt cctcacgcgt       120
     ctcgctaatt atggcatccc tctggctccc gagcagattg tgtgcacgct cggcccgaag       180
     agcgcggagc tctccatcat ggaagacctg ctccgcgcgg gtatgtccgt cgcgcgcttc       240
     aacttttcgc acggctccca cgagtaccac cagggcacgc tcaacacgct gcgtcaggcg       300
     atgctcaaca ccaggctgat gtgcgcggtg cttttggaca ccaagggacc ggagatccgc       360
     acgggaatgc tcaagggggg caagcccgtc ttgatggagg ctgggcgcga ggtgacgatc       420
     cacaccgact acaccttaca cggagacgaa cacaacatcg ccatgagcta caagaagcta       480
     cccaacgacg tcgcgccggg cgcggagatc ctgatcggag acggcagcat cgtcatggtc       540
     gtgctatcat gccaccccga gaacggcacg gtcaggtgca ggtgcgccaa caccgccatg       600
     ctgggcgagc gcaagaacgt caacctccct ggcgttgtcg tcgaccttcc aaccatcacc       660
     gagaaggatc gcgacgacat cctgggttgg ggcgtgccca acggcatcga tttcatcgcc       720
     gcgtcgttcg tgcgcaaggg tagcgacgtg aggtacatca gggaggtcct cggcgaggag       780
     ggcaagtcca tcaagatcat ctccaaggtt gagaaccagg agggcctggt caactttgac       840
     gacatcctgg aggagagcga cggcgtgatg gtcgcgcgcg gcgacctcgg gatggagatc       900
     ccgaccgaga agatctttct cgcgcagaag ctcatgatcg agaagtgcaa cgccgcgggt       960
     aagcccgtgg tgacggcgac gcagatgctc gagtcgatgg tgaagaaccc gaggcccacg      1020
     cgagccgagg ctaccgacgt cgccaacgcc gtcctcgacg gcaccgactg cgtgatgctc      1080
     tcgggggaga cggcggccgg tgccttcccg gtggacgcgg tgcgggtgat gagtaagata      1140
     tgtcgcgagg cggaggtgag catcgaccac taccagctgt tcaagagcat cctcgcgcag      1200
     gtgcccatac ccatgcagcc cctcgagtct ctcgcgtcga gcgcggtgcg aacggcgcag      1260
     aaggttcgcg cggcgctcat cgtggtgctg acccacggcg ggagcaccgc gagactggtg      1320
     gccaagtacc gcccggcggt tccggtgctg accgtgttcg tgcccacgct caccacggat      1380
     tcgctcacgt ggcagtgcag cggcgagtcc cccgcgaggc aggctaacct cacgcgcggt      1440
     ttgatcccgc ttctggctga gggcagcgcg agggcgacgg acacggacac cacggacgag      1500
     atcctccacg cggcgatcga tcacgccaag gcggcggggt actgcgccag cggagagtgc      1560
     atcgtcgcgc tgcatcgcat cgggaacgcg tcggtgatta agattgttaa catcccgtga      1620
//

If you have problems or comments...

PBIL Back to PBIL home page