(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE369

MICSR_1.PE369        Location/Qualifiers
FT   CDS_pept        join(complement(710404..710784),complement(709621..710307))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636999"
FT                   /orf_name="MICPUN_105273"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO62204.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR000637"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="InterPro:IPR020478"
FT                   /db_xref="UniParc:UPI000199A8B1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P6"
FT                   /transl_table=1
FT                   /translation="MHPPPEGLSQAPAKRGRGRPRKDAPKPIPAPKEAPAKRGRGRPRK
FT                   DAPATEKTAPEKKPAKPNAAVKRRAPPAVKEVGQHSDDESLDELIAAEKAKERAPPPPP
FT                   EPAVENWTISMATPMGTLPVEVTSLVTVTDIKQLVTAKTGGRLPPDRQIIKLNERLIDD
FT                   FGPNATLANHGLKHRSMLTLTFIRNAKSPAKSPTVDRTREHSRALQTVPSPPREERPAK
FT                   ERRTGWQPESVTRRVGPRERDQSAQGTKHKWTREESELVAEGVAKYGYGEWAAIQKELF
FT                   AESARTSTDIKDRWRNMLKAASKPNDFKFRSFMDDDLREQINEAQNKADEYQQKKLMEV
FT                   ERQRQEMIRVRGQIA"
     atgcaccccc cccccgaagg tttgtctcag gcgcccgcga agaggggacg aggcagaccg        60
     cgcaaggacg ccccgaagcc gatacccgcg ccaaaggagg ccccggcgaa gaggggacga       120
     ggcaggccgc gcaaggacgc cccggctact gagaagaccg ctcccgagaa gaagcccgcg       180
     aagccaaatg ctgccgttaa gaggcgcgcg ccccccgcgg tgaaggaggt tggccagcac       240
     tccgacgacg agagcctgga cgagctgatt gcggcggaaa aagcgaagga gagagcgccg       300
     cccccgcctc cggagcccgc ggtggagaac tggacaatct ccatggcgac ccccatgggc       360
     accctgccgg tcgaggtgac gtccttggtg acggtgacgg acatcaagca gctcgtcacg       420
     gcaaagaccg ggggaaggct acccccggat cgacagatca tcaagctgaa cgaacggctc       480
     atcgacgact ttggcccgaa tgcgacgctc gccaaccacg gcttgaaaca ccgctcgatg       540
     ctcacgctca cgttcatccg gaacgccaag tctcccgcca agtccccgac cgtggacagg       600
     acgcgcgaac actcgagagc gctccagacg gtgccgagcc cgccaagaga agagcgcccc       660
     gccaaggagc gccggacggg ttggcagccg gagagcgtga cccgccgcgt gggtccccgc       720
     gagagggacc agagcgccca agggaccaaa cacaaatgga cgcgagagga gagcgagctc       780
     gtggccgagg gagtcgctaa gtacgggtac ggggagtggg cggcgattca gaaggagctg       840
     ttcgcggagt ctgcgcgcac ctccacagac atcaaggacc gatggaggaa catgctcaag       900
     gcggcgagca agccgaacga cttcaagttt cgctccttca tggacgacga tttgcgcgag       960
     cagatcaacg aggcgcagaa caaggctgac gagtaccagc agaagaagct gatggaggtg      1020
     gagaggcaga ggcaggagat gatcagggtt cgggggcaga tagcgtga                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page