(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE370

MICSR_1.PE370        Location/Qualifiers
FT   CDS_pept        join(complement(712198..712947),complement(711736..712143),
FT                   complement(711058..711630))
FT                   /codon_start=1
FT                   /gene_family="HOG000198032" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637000"
FT                   /orf_name="MICPUN_79957"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62205.1"
FT                   /db_xref="HOGENOM:HBG559594"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="UniParc:UPI000199A8B2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P7"
FT                   /transl_table=1
FT                   /translation="MTAARAAASALGAKTEIPAPRRPVGLSRAVRARPRRALAEDRDVS
FT                   KLSSPGRPRTLGWGRKRGSVGPDEDLLADPDTHGYCVYSHADWSYAYKSVAGEFDSIRD
FT                   GGDVVGTIPDELIGGVLYRNGPGLFERGGREYNHMLDGDGYVLRFEFSDAKTARFASRF
FT                   VRTKEFRAEEEADDVLYRGTFGTMRAGGPLRNALDLHQKNLANTNILAWGGKVYALYEA
FT                   GRPVELDPKTLETVGEVDLNGRLSGGMFAFTAHPHVDPNTGRVVGWGWTSAVAKRSVEA
FT                   TFWEWDKNWGEVASTEYSMSGCEAAPHDFAVTESWYVMIQNCLRVDPLLYLAGVKGAGE
FT                   CLVSQPEDPVTVHLIPRRDAGFDGGADKSGRAAVAAAGPRESFEIHLEPGSFLGEWSQS
FT                   AGWDFDIATSLSPDFNNIPRTLLWRYRINARTGTVFREPAPGCEDLCIDHPHVNPMFEG
FT                   RRECRYVYASISNEVRCSGPPLGYVRIDVATGKTQRWWAGNRTFCEEVVLVPKKGSDGS
FT                   PGSDDRCWVLGMCVAHDAEGAGRSSLVVLDGEDLGKGPVARVWLDNQIPHGLHGMFVPA
FT                   "
     atgaccgccg cccgtgccgc ggcgagcgcg ctcggcgcga aaacagaaat tcccgcgcct        60
     cggcggcccg tcggtctctc gcgcgcggtc cgcgcccgac cccgccgggc actcgccgag       120
     gatcgtgacg tgtccaaact ttcatccccg ggacggccgc gtacgctcgg ctggggccgc       180
     aagcgcggta gcgtgggacc cgacgaggac ctcctcgcgg acccggatac ccacggatac       240
     tgcgtgtact cccacgccga ctggtcctac gcgtacaagt ccgtggcggg cgaattcgac       300
     agcatccggg acggtgggga cgtcgtcgga accatccctg atgagctcat cggcggagtg       360
     ctctaccgca acggcccggg actgttcgag cgcgggggca gggagtacaa tcacatgctc       420
     gacggggacg ggtacgtcct tcgcttcgag ttcagcgacg cgaagaccgc ccggttcgcc       480
     agcagattcg ttcgcacgaa ggagtttcga gccgaggagg aggcggacga cgttctttac       540
     cggggcacgt ttgggacgat gcgcgccggc gggccgttac gcaacgcgct cgaccttcac       600
     cagaagaacc tggccaacac gaacatactg gcgtggggag ggaaggttta cgcgctgtac       660
     gaggccggcc ggcccgttga gctcgatccg aagacgctcg agactgtggg cgaggttgac       720
     ctgaacgggc ggctgagcgg gggcatgttc gcgttcaccg cacaccctca cgtggatccg       780
     aacaccggcc gggtcgtcgg ctggggctgg accagcgccg tggcgaaacg gtccgtggag       840
     gccacgttct gggagtggga caaaaactgg ggcgaggttg cgtccaccga gtactcgatg       900
     tcggggtgcg aggctgcgcc gcacgacttc gccgtgaccg agtcgtggta cgtcatgatc       960
     cagaactgcc tccgggtgga tccgctgctg tacctggcgg gcgtgaaggg cgcgggggag      1020
     tgcctggttt cgcaacccga ggacccggtc acggttcacc tgattccgcg gcgcgacgcg      1080
     ggattcgacg gcggcgcgga caaatccggc cgcgccgccg tcgccgcggc ggggcccagg      1140
     gagtcgttcg agattcactt ggagcccggt tcgtttctgg gcgagtggag tcaatccgcc      1200
     ggttgggact ttgacatcgc cacgtctctg tccccggact tcaacaacat cccgaggacg      1260
     ctgctgtgga ggtacaggat aaacgcgagg accgggacgg tgttccggga acccgcgccg      1320
     gggtgcgagg atctgtgcat agaccacccg cacgttaacc cgatgtttga gggccgacga      1380
     gagtgccgat acgtgtacgc gtcaatctcc aacgaggttc gatgcagcgg accgccgctg      1440
     gggtacgtgc gcatcgacgt ggccacgggg aagacccagc ggtggtgggc cgggaacagg      1500
     actttctgcg aggaggtggt gctggtgccc aagaagggaa gcgacggctc gccagggtcg      1560
     gatgacaggt gctgggtcct cggcatgtgc gtggcgcacg acgcggaggg cgcgggacgg      1620
     agctctctcg tggtgttgga cggcgaggac ctgggtaaag gaccggtggc gagggtgtgg      1680
     ctggacaatc agattcccca cggtctgcac gggatgttcg tgccggcgta g               1731
//

If you have problems or comments...

PBIL Back to PBIL home page