(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE371

MICSR_1.PE371        Location/Qualifiers
FT   CDS_pept        complement(713118..714548)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637001"
FT                   /orf_name="MICPUN_56949"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62206.1"
FT                   /db_xref="UniParc:UPI000199A8B3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P8"
FT                   /transl_table=1
FT                   /translation="MADPPPIRGILKKGRFSQPMPAVGAVDVGDDSTDVGNGRQNSDPP
FT                   TATSVDEQLPPGAQRAMTSSVAGAETSGGSDDGASCPRYFGSKSIRDSIAKHVGSVTKS
FT                   SQEVLELRKQFAGLAAAYDDDSESESGSDAANVPDDAFTLQEDRVHGGERGAALALLSP
FT                   VHPKMQPRAFGGEIQADEDPPAPPPPPPPAAAASAAPIGSRRSDGSTARGSSGRGLSRF
FT                   SRDLDVEAKDFPDVSVHSGEEPSPLPTPEVSKHGTNEAWLFIKDQSQQQRQREGRPPLH
FT                   LMNSGRSEATSSIGAESDDGSSAPTSRAGSARRSGSGMHRSASVVSFRGDGGSEESLHD
FT                   VHVIGSVSDLKKEKKGKKSSTFKWLKKEASALAYEFGLKKKKKACLEVDAKLKESRRNM
FT                   VDNLDDASVHNEGRRAWETRDVSLRGGGEFFHADVMRRSASSPKLQGGTTGLGDGDEAD
FT                   SPMSLPDGLERFTREENE"
     atggcagatc cgccgcccat ccggggcatc ctgaaaaagg gacggttctc gcagccgatg        60
     cccgcggtgg gcgcggtgga cgtcggggac gactcgaccg atgtcggaaa cggccgacaa       120
     aacagcgatc ctccaacagc gacctcggtt gatgagcaac tgccgccggg tgcgcagcgg       180
     gcgatgacga gcagtgtcgc gggggcggag acatctggag gatcggatga cggcgcgtcg       240
     tgtccgcggt acttcgggtc gaagtccatc cgggatagca tagccaagca cgtggggtcg       300
     gtcacgaaga gctcgcagga ggtgctcgag ctgcggaagc agttcgcggg actggcggcg       360
     gcctacgacg acgacagcga gagcgaaagc ggaagcgacg ccgcaaacgt gccagatgac       420
     gcgtttaccc tccaggagga ccgcgtgcac ggcggcgaac ggggcgctgc gctggcgttg       480
     ctctcgccgg tgcatccaaa gatgcagccg cgcgcgtttg ggggggaaat ccaggcggac       540
     gaagatccac ccgcaccgcc gccgccgcct ccgcccgccg ccgccgcctc cgcggcaccg       600
     atcggcagca gacgcagcga cggctccacg gcgaggggat cttccggtcg cgggctgagc       660
     cgattctccc gcgacctgga cgtcgaggcg aaagatttcc ccgacgtgtc ggtgcacagc       720
     ggcgaggaac cgtccccgct gcccaccccg gaggtctcca agcacgggac gaacgaggcg       780
     tggctgttca tcaaggatca atcgcagcag cagcgccagc gggaggggcg cccaccgctg       840
     cacctgatga acagcggccg gtcggaggcg acgagctcca tcggcgccga gtccgacgac       900
     ggctccagcg ctcccacctc tcgagcgggg agcgcgcgca gaagcggcag cggcatgcac       960
     cgctccgcgt ccgtggtctc cttccgcggc gatggcggta gcgaggagtc gctgcacgac      1020
     gtgcacgtca tcgggagcgt cagcgatctc aagaaggaga agaaggggaa gaagagctcg      1080
     acgttcaagt ggctgaagaa ggaggcgtcg gcgctcgcgt acgagttcgg tctcaagaaa      1140
     aagaagaagg cttgtctgga ggtggacgcg aagctgaagg agagcagacg gaacatggtc      1200
     gataacctgg acgacgcgag cgtgcacaac gagggacgca gggcgtggga gacgagggac      1260
     gtgagcctca ggggcggggg tgaatttttc cacgcggatg tcatgcggcg gtcggcgtcg      1320
     tcgcccaagc ttcagggggg aacgacgggg ctgggcgacg gggacgaggc ggactcgccg      1380
     atgtcgctgc cggacgggtt ggaacggttc acccgggaag agaacgagta g               1431
//

If you have problems or comments...

PBIL Back to PBIL home page