(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE372

MICSR_1.PE372        Location/Qualifiers
FT   CDS_pept        join(714866..714985,715104..>715874)
FT                   /codon_start=1
FT                   /gene_family="HOG000233016" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637002"
FT                   /orf_name="MICPUN_71399"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO61778.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI000199A8B4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P9"
FT                   /transl_table=1
FT                   /translation="MGGCLSQPANIQAPASVEIVFDRKVEDDYDIGPKLGEGVQGVVFS
FT                   GVCKSTGTKVAVKRTHIGSYGSSASRASAFAEIELLSYCDHPNVLRLMGAYQTGGDINM
FT                   VCKKVEGWNLIQYLIQLDKEEAAGRSAEDIAAEKMSLMHQLVDAVAHVHARDIVYRDLK
FT                   PANLMISEQKPRQLTLIDFGRATHLDRAARLEKEQPMGTSLFQAPEVEERAAYGQQSDM
FT                   WAVGVLVYLLISGGMPFEHSIAGLYKVLAGQYRPMDESFSPEAKDLVSRLLVVDPDKRL
FT                   NAAQCTQHPFFTREGL"
     atgggtggat gcctgtcgca gccggcgaat attcaggctc cagcatccgt ggagattgtg        60
     ttcgaccgca aggtcgagga tgattacgat atcgggccaa agctaggcga gggcgtgcag       120
     ggtgtcgtct tcagcggcgt gtgcaagagc accggcacga aggtggccgt caagcgcacc       180
     cacatcggct catacggctc gtccgccagc cgcgccagcg cgttcgccga gattgagctc       240
     ctctcctact gcgaccaccc caacgtcctc cggctcatgg gcgcgtatca gaccggcggc       300
     gacatcaaca tggtctgcaa gaaagtcgag ggctggaacc tcatccagta cctcatccag       360
     ctggacaagg aagaggccgc ggggcggtcc gcggaggaca tcgcggcgga gaagatgtcg       420
     ctcatgcatc agctcgtcga cgccgtcgcg cacgtgcacg cgcgagacat cgtctaccga       480
     gacctcaagc ccgcgaacct catgatcagc gagcagaaac cgaggcagct gacgctcata       540
     gacttcggcc gcgccacgca cctggaccgc gcggcgaggc tggagaagga gcagccgatg       600
     ggcacgagcc tgttccaggc gcccgaggtt gaggagcgcg ccgcgtacgg tcagcagtcc       660
     gacatgtggg ccgtgggcgt gctcgtgtac ctcctcatca gcgggggcat gcccttcgag       720
     cactccatcg cgggtctgta caaggttctc gcgggccagt acaggccgat ggacgagagc       780
     ttctcgcccg aggctaagga tctggtctcg aggctgctgg tggttgaccc cgacaagagg       840
     ctcaacgcgg cgcagtgcac gcagcacccg ttcttcacca gggaagggct c                891
//

If you have problems or comments...

PBIL Back to PBIL home page