(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE374

MICSR_1.PE374        Location/Qualifiers
FT   CDS_pept        join(complement(727082..729780),complement(726241..726994),
FT                   complement(723904..725445))
FT                   /codon_start=1
FT                   /gene_family="HOG000264435" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637004"
FT                   /orf_name="MICPUN_93685"
FT                   /product="Predicted protein"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="transferase activity"
FT                   /protein_id="ACO62208.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="HOGENOM:HBG560171"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniParc:UPI000199A916"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q1"
FT                   /transl_table=1
FT                   /translation="MAGAASEASDLTTPLISGNQPAATFSSRGGNRRSGRRRASGESGA
FT                   GAHDSDGGSPAPRHSHVESPLAAADHEGITVEPLAPLADLLVEATNTRVRQGYLSGDWL
FT                   AERLPAYSSISDLIANSSRPAITPVDARASLTHTQLKDLIYRVDDELKTWGVTQAGSRV
FT                   GVAVPNGPELMSVLLSVIDRHTCVPVNPATTPQEMHEELRATGVVALVYQGGNEMAVTM
FT                   RKLCEKLKIVPLAITPDPNVGGLFSISSDAGDASGSRAGPGTYAPPDSDKNRTALVLHT
FT                   SGSTGKKKIVPISLHQLVLGATAIGASSGLGQNDVCLNFMPLFHVGGICRNLLAPIFAG
FT                   GSTVAMPFFDADDFWQTAVQKQCTWYYGAPTMHLLVVNSAKAMPTDQIPETKIRFIANA
FT                   AGPLLPSVAIELRKVFNGAAVLTSYGMTECMPIACPPPGYALERAGSSGQAICPEIAIV
FT                   DDSGERVANGRVAHIVVKGSIVTRGYENDPEATKASFHPGGWFKTGDMGWMDADGYLYV
FT                   TGRSKEVINRGGEIISPAEVEEALQSHPGVADVVAISIPHATLQETVAVVVVPTRGIQE
FT                   PGLRQLCQHASDRLPPAKWPQCLVLVESIPKLATGKVSRSAIAKSLDIQEIRDGMWELD
FT                   VTFEASLEVNAGRGSSGVAGHRAIATRDEATKRVAEALSKASGVEDTAACIDTTGSNAL
FT                   IGAVTPADADTEKVMSFACRCLPGFLEPKDVIAVDEIPRAADGKCDAQALLALWKGQKA
FT                   AGVNGAAFTATQRAVAEAWANTLNCDARTVGLDDDFFQVGGSSIVAGQLAADIRRKLSS
FT                   NLTGADIFRYRTVKEIAAKVEKEGGGTKDGNKTEGGLPPSMASKPLGPMEWTRSYSSTS
FT                   FFALLFQSLPLLVFAPMQKILRWTIFLNMAAGVDPENEHFHHLRLVAFFVALVFTGLIS
FT                   FVLFPVMTVMLKWTVLGRLKPGLHPLWGSVYIRWWLSNKAVEVSGFGIFGMSDGLFRIY
FT                   LRMMGARVGRGAKIGRLVRIADFDMLEIHTNAAVDDYAHLRAAEVRRGALRVAPVYLGP
FT                   GSTVCTRAVVGPGGVVPQGATLGPYMSWRELDVTNPKTMAQMEEHRKIARMRQPQPGFG
FT                   SQMLAWPIVFVCEVVAWIPWIFVFVVLIRSQGLYLSIPGQGGLHDCITWFMDPFRLGVI
FT                   FAARVGHNIFGPLLQLIWIVLVKWIVVGKFKPGPLPRTYLAREWELTRRWLMNKLLPKG
FT                   DFRGALAVLGKHYEYTSIVYRMLGAKIGKRVFWPGSGVLVADGMYDLVDIGDDVVWGSR
FT                   SMVFPADCTSSLPVSICRGANVSDRCVIYAGVTLMDDACLGSGAVAPRKMKYDYGSIHV
FT                   GSRNGACVQLDPGSKPDDSVPREPKPFGRAVYQRKATYFLPHWQVMPFVFSFFIALRTA
FT                   YSVMPIWVSWYLVAIITWDLGNNFWTEMPEWRYLLLLIFVYLWVNMIHVVVRFIIDTGL
FT                   KWLIIGRREPGLYPWDRSSYCIRWKIFESLCSDTLHSLRLIGGSAFLPFFYNIMGSRIG
FT                   RRVCLYPTGADPPMVEPDLVVIEDGACVNFTHIICHTNTLGSFALNHIVIKSGATLSTE
FT                   SRIMGGVVIGEDAVLLEHTMAMVGDVVEPGDIWQGWPVQAIAKADEVAKSAKDSAEKAE
FT                   KVHEGKVLPLGLKEMPKPHKSYGSHR"
     atggccggcg cggcctccga ggctagcgac ctgacaaccc cgctgatcag cggaaaccag        60
     cccgcggcta cattctcgtc gcgaggaggc aaccgcagga gcggacgccg tcgcgcgagc       120
     ggcgagagcg gcgcgggggc gcacgactcc gacgggggca gccccgcgcc tcgccactcg       180
     cacgtcgagt cacctctcgc cgccgcggac cacgagggaa tcaccgtcga gcccctcgcg       240
     cccctcgcgg acctcctcgt cgaggccacc aacacgaggg tgcgccaggg ctacctctcc       300
     ggcgactggc tcgcggagcg cctgcccgcg tactcgtcca tcagcgatct catcgccaac       360
     tcgtccagac ccgccatcac gccggtggat gcgcgcgctt cgctgacgca cacccagctg       420
     aaggacctca tctacagggt cgacgacgag ctcaagacgt ggggggtgac ccaggcgggt       480
     tcgcgcgtgg gtgtcgccgt ccccaacgga cccgagctca tgtccgtgct cctctccgtc       540
     atcgacaggc acacgtgcgt gcccgtgaac ccggccacca cgccgcagga gatgcacgag       600
     gagctacgcg ccaccggggt ggtggccttg gtgtaccagg ggggtaacga gatggcggtg       660
     accatgcgta agctgtgcga gaagctcaag attgtgccgc tggccatcac cccggatccc       720
     aacgtcggcg gtttgttttc aatctcgagc gacgcgggcg acgcctccgg tagccgcgcg       780
     ggccccggga cgtacgcgcc ccccgacagc gacaagaacc gcaccgcgct cgtgcttcac       840
     accagcggca gcacgggcaa gaagaagatc gtgcccatct cgctgcacca gctcgtgttg       900
     ggcgcgacgg caatcggcgc atcctcgggc ctgggacaaa atgacgtgtg cctcaacttc       960
     atgccgctgt tccacgtcgg aggcatctgc cgcaacctcc ttgcgcccat cttcgccggg      1020
     ggtagcaccg tcgcgatgcc cttcttcgac gccgacgatt tctggcagac ggcggtgcaa      1080
     aaacagtgca cctggtacta cggagctccc accatgcatc tgctcgtggt caactccgcg      1140
     aaggccatgc ccacggatca gattcccgag accaagatca ggttcatcgc gaacgccgcg      1200
     ggcccgctct tacccagcgt ggccatcgag ctcaggaagg ttttcaacgg tgccgcggtg      1260
     ctcacctcgt acggcatgac ggagtgcatg cccatcgcgt gtccgccccc ggggtacgcc      1320
     ctggagcggg cggggagctc gggccaggcc atctgccccg agatcgccat cgtcgacgac      1380
     tccggcgagc gcgtggcgaa cggccgcgtc gctcacatcg tggtcaaggg gagcatcgtg      1440
     acgcggggtt acgagaacga tcccgaggcg accaaggcga gtttccaccc cggcggctgg      1500
     tttaaaaccg gtgacatggg atggatggac gccgatggat acctctacgt caccgggcgg      1560
     agcaaggagg tgatcaacag aggcggcgag atcatctccc cggcggaggt ggaagaggcg      1620
     ctccagtcgc acccgggtgt cgcggacgtg gtggccatct ccataccgca cgcgacgctt      1680
     caggagactg tcgccgtcgt ggtggtaccc acgcggggaa tccaggaacc cggcctgcga      1740
     cagctgtgcc agcacgcgag cgacaggctg ccgcccgcga aatggcccca gtgcctcgtg      1800
     ctcgtggagt ccattcccaa gctggcgacg ggaaaggtga gcaggagcgc catcgcgaaa      1860
     tcgctggaca ttcaggaaat tcgcgacggg atgtgggagc tcgacgtaac cttcgaggcg      1920
     tcgctcgaag tcaacgcggg acgcggttca tcgggcgtag cggggcacag ggccatcgcg      1980
     accagagacg aggccacgaa acgcgtcgcc gaggcgctct ccaaggcttc cggcgtcgag      2040
     gacacggccg cgtgcatcga caccaccggg agcaacgcgc tgattggcgc ggtgaccccg      2100
     gcggatgccg acactgaaaa ggtcatgtcc ttcgcgtgca ggtgcctccc gggcttcctc      2160
     gagcccaagg atgtcatcgc ggtggacgag atcccgcgcg ccgcggacgg caagtgcgac      2220
     gcgcaggcgc tcctcgcgct gtggaagggt cagaaggcgg ctggcgtcaa cggcgcggct      2280
     ttcaccgcca ctcagagggc ggttgccgag gcgtgggcga acaccctcaa ctgcgacgcg      2340
     cggaccgtgg gactggacga cgacttcttc caggttggtg ggagttccat cgtagccggg      2400
     cagctcgcgg ctgacatccg tcgcaagctc agctccaacc tcacgggtgc cgatatcttc      2460
     cgctaccgca ccgtgaagga gatcgccgca aaggttgaga aggagggagg cgggaccaag      2520
     gacggaaaca agaccgaggg cggcctgccc ccgagcatgg cgagcaaacc gctgggtccc      2580
     atggagtgga cgaggtccta cagctccaca tcgttcttcg cgctgctgtt ccagtcactg      2640
     ccgctgctgg tcttcgcgcc gatgcagaag attcttcgct ggacaatttt cctcaacatg      2700
     gcggctgggg ttgatccgga gaatgaacac tttcaccacc tgcgcctggt ggcgtttttt      2760
     gtggcgcttg tattcacggg actgatttcg tttgtgctgt tcccggtcat gaccgtgatg      2820
     ctcaagtgga ccgtgctcgg tcgcctgaag cccggtttgc acccgctgtg gggcagcgtg      2880
     tacatcagat ggtggctttc gaacaaggct gtggaggtta gcgggtttgg catctttggg      2940
     atgtccgatg gcctcttcag gatctacctg aggatgatgg gcgcaagggt gggacggggt      3000
     gccaagatcg ggcgactcgt ccgcatcgcg gactttgaca tgctcgagat ccacaccaac      3060
     gccgcggtgg acgactacgc ccacctgcgc gcggcggagg tgaggagggg cgcgctgagg      3120
     gtggcgcccg tctacctcgg acccggctcc accgtctgca ctcgcgccgt cgtcggaccc      3180
     ggcggcgtcg tcccgcaggg cgccaccctg ggcccgtaca tgtcctggcg cgagctcgac      3240
     gtgaccaacc cgaagacgat ggcgcagatg gaggaacaca ggaagatcgc gcgcatgcgc      3300
     cagccccagc cgggctttgg ctcgcagatg ctggcgtggc ctatcgtctt tgtctgcgaa      3360
     gttgtcgctt ggattccttg gatcttcgtg tttgtcgtgc tgatccgctc gcaggggctc      3420
     tatctgagca ttccaggaca gggcggcctg cacgactgca tcacctggtt tatggacccc      3480
     ttccgcctcg gcgtcatctt tgccgcgagg gtgggccaca acatcttcgg cccgctcctg      3540
     cagctcatct ggatcgtgct ggtgaagtgg atcgtcgtgg gcaagttcaa gcccgggccg      3600
     ctgccccgta cctaccttgc gagggagtgg gagctcaccc gcaggtggct catgaacaag      3660
     ctcctcccca agggtgactt caggggcgcg ctcgccgtgc tggggaagca ttacgagtac      3720
     acctccatag tgtacaggat gctgggtgcg aagattggga agcgggtgtt ctggcccgga      3780
     tcgggcgtgc tcgtggccga cggcatgtac gacctcgtgg acatcggcga cgacgtcgtc      3840
     tggggctcga ggagcatggt ctttcccgcc gactgcacca gctcgcttcc cgtgagcatt      3900
     tgcaggggcg ccaacgtctc ggacaggtgc gtcatctacg cgggtgtgac gctcatggac      3960
     gacgcgtgcc tcggatccgg tgcagtggcg cccaggaaga tgaagtacga ctacggcagc      4020
     atccacgtgg gctctcgcaa cggcgcctgc gtgcagctgg atcccggcag caagcccgac      4080
     gactccgtgc cccgcgagcc caagccgttt ggccgcgcgg tgtaccagcg caaggcgacg      4140
     tatttcctgc cgcattggca ggtgatgccc ttcgtcttct cgttcttcat cgcgcttcgc      4200
     acggcctatt ccgtcatgcc catctgggtg tcgtggtacc tcgtcgcgat aatcacctgg      4260
     gatttgggaa acaacttttg gacggagatg cccgagtgga ggtatttgct gctgttgata      4320
     tttgtttatc tctgggtgaa catgatccac gtggtggttc ggttcatcat cgacaccggc      4380
     ttgaagtggc tcatcatcgg caggcgcgaa ccgggtctgt acccgtggga ccgcagctca      4440
     tactgcatcc ggtggaagat cttcgagtcg ctgtgcagcg ataccctgca ctcgctgcgg      4500
     ctcatcggcg gctccgcgtt tctccccttc ttctacaaca tcatgggaag caggatcggg      4560
     cggcgggtgt gcctgtaccc caccggcgca gatcccccga tggtggagcc ggacctggtg      4620
     gtcatcgagg acggcgcgtg cgtcaacttc acacacatca tttgccacac gaacaccctc      4680
     ggatccttcg ccctgaacca catcgtgatc aagagcggcg caaccctgag caccgagtcg      4740
     aggatcatgg gcggcgtcgt catcggcgag gacgcggtgc tcctcgagca caccatggcc      4800
     atggtgggcg acgtcgtgga gcccggcgac atctggcagg gttggccggt gcaggccatc      4860
     gcaaaggccg atgaggtggc caagtccgca aaagacagcg cggagaaggc ggagaaggtg      4920
     cacgagggta aggtgcttcc gctcggcctg aaggagatgc ccaagccgca caagtcttac      4980
     ggctcgcacc gctaa                                                       4995
//

If you have problems or comments...

PBIL Back to PBIL home page