(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE375

MICSR_1.PE375        Location/Qualifiers
FT   CDS_pept        730852..732429
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637005"
FT                   /orf_name="MICPUN_52223"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO61779.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="InterPro:IPR004333"
FT                   /db_xref="UniParc:UPI000199A917"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q2"
FT                   /transl_table=1
FT                   /translation="MSPRRAAAKHAETETVDATPEAMENPAEEVVAEQSASGDPTKAET
FT                   VDGSAEVAKQGTKRKAEAGARMDDPSPKNEPTGSPEYNREDEMGGSKSRVCRVDGCDVV
FT                   FSTAHECRARACQKHCSALFVRLKGARPDEQFRFCYQCHKFHPLDNFRGPDGTLLARHN
FT                   CSQSQVQRLERRKRKDALKASKKMAEALGLNHPAQIEAVNLIGASNVGQLLLANQLVMH
FT                   ERLLAAIGAGGGAAQGLGAAQGLGAAQGLGAAQGLGAAQGLGAAQGLGAAQGLGAAQGL
FT                   GAAQGLGAAQGLGAAQGLGAAQGLGAAQGLGAAQGSGAAQGLGAAQGLGALQALIGAQG
FT                   VGAAGSAQANALNQQLGKQQLPQQLEALAALRQREQLAMLNQAAGVKGLAGTQLSGLGP
FT                   AVANGGLHGGAGVSAMLDAAVRQEKLNMLSATMANMVPSPAVGPAAASGLQGLQGLQGA
FT                   AAGLQGLQGAAAGLQGLQGAAAGLQGAAAGLLWLQGAAANAPGANLNGDILKSLMGQLG
FT                   HNGQNQPQ"
     atgtctcccc gacgcgccgc ggcgaaacac gccgagacgg agacggtcga cgcgacgccc        60
     gaggcgatgg aaaatcccgc ggaggaggtg gttgccgagc aaagtgcaag cggcgacccg       120
     acgaaggccg agacggtcga cggctccgcc gaggtagcga agcaggggac gaagcgcaag       180
     gctgaggctg gagcgaggat ggacgatccc tctcccaaga acgagcccac cggctcgccc       240
     gagtataacc gcgaggatga aatgggcggc agcaagagcc gcgtctgccg cgtcgacggg       300
     tgcgacgtcg tcttcagcac cgcgcatgag tgcagggcgc gcgcgtgtca gaagcactgc       360
     tccgcacttt tcgtgcggct caagggcgcg agacccgacg agcagttccg cttctgttac       420
     cagtgccaca agttccaccc gctggacaac ttccgcgggc ccgacggcac gctcctcgcg       480
     cggcacaact gctcgcagtc gcaggtgcag aggctggagc gccgaaagag gaaagatgcg       540
     ctcaaggcat cgaagaagat ggcagaggct ctcggcctga accaccccgc gcagatcgag       600
     gcggtgaatc tcataggcgc cagcaacgtg ggccagctcc tcctggccaa ccagctcgtc       660
     atgcatgagc ggctcctcgc cgccatcggc gccggagggg gagccgcgca gggcttggga       720
     gccgcgcagg gcttgggagc cgcgcaggga ttgggagccg cgcagggatt gggagccgcg       780
     cagggattgg gagccgcgca gggattggga gccgcgcagg gcttgggagc cgcgcagggc       840
     ttgggagccg cgcagggctt gggagccgcg cagggcttgg gagccgcgca gggcttggga       900
     gccgcgcagg gcttgggagc cgcgcagggc ttgggagccg cgcagggatc gggagccgcg       960
     cagggattgg gagccgcgca gggattggga gccctccagg ctttgatcgg ggcgcagggc      1020
     gtgggcgcgg cgggatccgc gcaggcgaac gcgctgaacc agcagctcgg caagcagcaa      1080
     ctcccgcagc agttggaggc gctcgcggca ctccgccagc gcgagcagct cgcgatgctc      1140
     aaccaggcgg ccggcgtcaa aggattggcg gggacgcagc tcagcggcct cgggcccgcc      1200
     gtcgcaaacg ggggtctcca cggtggcgcc ggcgtgagcg ccatgctaga cgcggcggtg      1260
     aggcaggaga agctgaacat gctgtcggcg accatggcga acatggtacc gagtcctgcc      1320
     gtgggtcccg ccgcggcctc ggggctgcag gggctgcagg ggctgcaggg cgcggccgcg      1380
     gggctgcagg ggctgcaggg cgcggccgcg gggctgcagg ggctgcaggg cgcggccgcg      1440
     gggctgcagg gcgcggccgc ggggctgctg tggctgcagg gcgcggccgc caacgccccc      1500
     ggtgcgaatc tgaacgggga tattctcaag agtttgatgg gacaactggg ccacaacggg      1560
     cagaaccaac cgcagtga                                                    1578
//

If you have problems or comments...

PBIL Back to PBIL home page