(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE376

MICSR_1.PE376        Location/Qualifiers
FT   CDS_pept        complement(732650..733906)
FT                   /codon_start=1
FT                   /gene_family="HOG000193909" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637006"
FT                   /orf_name="MICPUN_107913"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="enzyme regulator activity"
FT                   /biological_process="regulation of protein catabolic
FT                   process"
FT                   /cellular_component="proteasome complex"
FT                   /protein_id="ACO62209.1"
FT                   /db_xref="GO:0000502"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0030234"
FT                   /db_xref="GO:0042176"
FT                   /db_xref="HOGENOM:HBG523170"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013143"
FT                   /db_xref="InterPro:IPR013586"
FT                   /db_xref="UniParc:UPI000199A918"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q3"
FT                   /transl_table=1
FT                   /translation="MADVAEGGEASATKDDTAGDNAGDGANAVPPTPPTPAQRELPETE
FT                   AYSHLLVLLLLLDANDPECKAASVAALNRLSQFNRRTLDALQARIVFYYSLAHERFGEL
FT                   AEVRPSLLALHRVAALRFDEMGQETILNLLMRNYLHYNMYDQAEKLRSKAQLPASRSNQ
FT                   QQCRYLYYLGRIRAIQLEYSDAKECLTQAHRKAPKLAKGFALELTKWITVVRLLLGEIP
FT                   EKKDLTTAVSGGAAAQRALLPYLELTGAVRLGDLEKFRAVQEAHEAAFRADKTTNLVTR
FT                   LRRNVIRTGLRRVSLAYSAISLDDVAQKLGLGEGDGDVEFVVAKAIRDGGIDATIDHDA
FT                   RTMHSSDATDVYSTGEPQAAFHARIAFCLDTHNEAVKAMRYPDKVKKGKGDGERKSAKD
FT                   RDLEELAMHIMDEDEMDEF"
     atggcggacg tcgccgaggg aggagaggct tcggcgacga aggatgacac agctggcgac        60
     aacgctggcg acggagcgaa tgccgttccg ccgacgccgc cgacgccggc gcagcgcgag       120
     cttcccgaga ctgaggcgta ctcccacctc ctcgtcctcc tcttactcct ggacgccaac       180
     gacccggagt gcaaagccgc gtccgtcgcc gcgctcaacc gcctgtcgca gttcaaccga       240
     cgcaccctcg acgcgctcca ggcgaggatc gtgttttact actcgctcgc gcacgagagg       300
     ttcggggagt tggcggaggt tcggccctcg ctgttggcgc tccaccgcgt cgccgcgctt       360
     cgattcgacg agatgggcca ggagacgatc ctcaacctgc tcatgcgcaa ctacctgcac       420
     tacaacatgt acgaccaggc tgagaagctt cggagcaagg cgcagctccc cgcgagccgg       480
     agcaaccagc agcagtgcag gtacctctac tacctgggac gcatccgagc gatccagctg       540
     gagtactcgg acgccaagga gtgcctgacc caggcgcacc gcaaggcgcc caagctcgcc       600
     aaggggttcg ccctggagct caccaagtgg atcaccgtcg tcaggctctt gctcggcgag       660
     atcccggaga agaaggacct gaccaccgcg gtttccggcg gcgcggcggc gcagagggcg       720
     ctcctcccgt acctcgagct caccggcgcg gtcaggctcg gcgacctcga gaagttccgc       780
     gccgtgcagg aggcccacga ggctgctttc agggcggaca agacgaccaa cctggtgacg       840
     cgactccgcc gcaacgtcat ccggaccggc ctccgccgag tgtcgctggc gtactcggcc       900
     atctccctcg acgacgtcgc gcagaagctc ggcctgggcg agggcgacgg ggacgtggag       960
     ttcgtcgtcg ccaaggccat cagggacggc ggcatcgacg cgacgatcga ccacgacgcg      1020
     aggacgatgc actcgagcga cgccacggac gtctactcga cgggcgagcc gcaggcggcg      1080
     tttcacgcga ggatcgcgtt ctgcctggac acgcacaacg aggcggtcaa ggcgatgagg      1140
     tacccggaca aggtcaagaa gggcaagggg gacggcgagc gaaagagcgc gaaggatcgc      1200
     gacctggagg agctggcgat gcacatcatg gacgaagacg agatggatga gttctga         1257
//

If you have problems or comments...

PBIL Back to PBIL home page