(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE377

MICSR_1.PE377        Location/Qualifiers
FT   CDS_pept        join(<734863..735075,735229..>735816)
FT                   /codon_start=1
FT                   /gene_family="HOG000194726" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637007"
FT                   /orf_name="MICPUN_71596"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61780.1"
FT                   /db_xref="HOGENOM:HBG434815"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="UniParc:UPI000199A919"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q4"
FT                   /transl_table=1
FT                   /translation="IALVTSGGTTAPLERTAVRFVDNFSSGSRGAASAEYLLRAGYAVV
FT                   FLHREGSLRPFDRKIPDAARWFYDSLIDLGGHFDMINRGTLLAVPFTTLFQYLNLLRAL
FT                   CTEMSSVPKPRRVMVYLAAAVSDFYVPWERLPTHKIQSREAGDAGPSNLPGIDATDDGG
FT                   VVIRLSQTPKMLGHVRSAWCPNAFVVGFKLETDPDILLEKANRSLVKYRMHLVVANEMH
FT                   RRKDRVALVEPEGKSTWVNRPADVADIEELLIGELARRHAKFVEE"
     atcgcgctcg tgacctcggg cggcaccacc gcgccgctgg agcgaaccgc ggtgcggttc        60
     gtcgacaact tcagcagcgg atcccgcggc gccgcgagcg ccgagtacct gctccgggcg       120
     gggtacgccg tcgtcttcct ccatcgcgag ggttcgctgc gacccttcga ccgcaagatc       180
     cccgacgccg cgaggtggtt ctacgacagc ctcatagacc tggggggcca cttcgacatg       240
     atcaaccggg gaaccttact cgcggtgccg ttcaccacct tgttccaata cctcaacctg       300
     ctcagggccc tgtgcacgga gatgagctcg gtgccgaagc cgcggcgggt catggtgtac       360
     ctggcggcgg cggtgtcgga tttttacgtg ccctgggaga ggctaccgac gcacaagatt       420
     cagagcagag aggctggcga cgcgggtccg agcaacttac ccggcattga cgccaccgac       480
     gacggcggcg tcgtcatccg gctgtcgcag actccgaaga tgctggggca cgtgcggtcg       540
     gcgtggtgcc cgaacgcgtt cgtcgtcggg ttcaagctgg agacggaccc ggacatcctc       600
     ctggagaagg ccaatagaag tctggtcaag taccggatgc atctggtggt ggcgaacgag       660
     atgcacaggc ggaaagacag ggtcgcgctg gtggaacccg aggggaaatc gacgtgggtg       720
     aaccggcctg ctgatgtggc ggacatagag gagcttctga tcggggagct ggcgcggcgc       780
     cacgcgaagt tcgtggaaga g                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page