(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE378

MICSR_1.PE378        Location/Qualifiers
FT   CDS_pept        join(complement(739742..739852),complement(735908..739612))
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637008"
FT                   /orf_name="MICPUN_56957"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62210.1"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI000199A91A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q5"
FT                   /transl_table=1
FT                   /translation="MPWERVLRETPSPYPGAVAWSHENLIAVGQERSVCILNPADIDGP
FT                   AGCVSLVDDARAKPANANDEDADDHGDDGDGGVPFPELTRPRRSTSLLSTRVVIHPNHR
FT                   PEVVARDLAWSPLGLAPPAVSPSGILGDGCLLAIASSAHRVTVHAPPRAESDAEWAKVC
FT                   DVSEMFASVAEAEGWLDDGGDAFDRSAFETNRRPRLPSPQYARLLLRAREAPLALPAVA
FT                   NGGGGRGEKRTALPAAGVGEGSSGGGGGGCWPTEPAKFPADSLRVGAAVEVRRRASSGA
FT                   DSRGADSGAAGGWRPGTVQSLVSAFNFRVRVCFDEPVRGAPRCVWLVCENDGEFPALRL
FT                   DGEGASAAGCHEFPSQSLGFEGASGVFELRPAQSGWKDGVVGEAEVAMTRRGGWVPAFV
FT                   DKGGAWIKLGVRGEGERSNVPPGTIRSRPRMAWIGEGCAHGAWRKATDSDYSGYKLSDF
FT                   TFPEDEEDDEEDEDEEGEEDKEGEEDPVAPKPEPTVAKVTIPKETDVVEKEELPDAAPV
FT                   AVAHRPAASATGKTRGRKPGEHFAAAYANELRASAKAAAAKTAAECGANDAPVKAVEAV
FT                   FTAAKVGDDVFAAVNDVTKANKSRRNAGLKDIALRVCDAFLAARAGAGITRLYPQGKHL
FT                   DKNDDKPLLEKVEKLVWEKVAPRVQKNKDKVRKELKPPTQNGYQLEIRENITQADDNDE
FT                   EEDVPIARRARAARARPILPADEDEDEEDDEDDPDASNASSSDDDEEDDDEPKPKRQRG
FT                   RRASITAASSADPASAAAAARRAAAAAALSVAWSPRLDRRPDEPPASVLAVGCKSGAVT
FT                   LWLVRRPATAGDGGAVDVEAMGRFRACDGCATSLAWTGDVRLGESPPGESPQNGESPQN
FT                   GESSPGESPGGGGFALVVGGSDGSVRTFTVSRKSLLAAAGAEGGRRGRRATRAVPLTPG
FT                   AELSPADGDPVTRVAVADSVKIDSDNRAHARPVIAAGKASGTVAAWRLAAHDSTSAEAT
FT                   WSARCHVQPVSGLAWCAAPEIENCAAVRLVSMHTTGAAVAYTVPTDPRARHDDWTLTDA
FT                   CVEDLTVASIDGLDLNGNTAGGGAKLPVSSHAGLASSPAGVLVATAAGFVASTYASGAT
FT                   MIQSRARRGRVAVAPPAALAAGRVKSHSMTEISGDAASGKLDDGAADESLSVACAARRL
FT                   PFLASDRGVSLWDVRAAAKHAGAGGARALESAAGEMQSTGGARASQLAKSLLCGAPEMF
FT                   VGFEPLSCEGCGRGYPRGEGWPGCGDCGLLLRPEDVTRAALSRAMI"
     atgccctggg agcgcgtact tcgcgagact ccttcgccgt accccggcgc ggtggcgtgg        60
     tcgcacgaga acctcatcgc ggtcggccag gagaggagcg tgtgcatcct gaaccccgcc       120
     gacatcgacg gacccgcggg atgcgtctcg ctcgtcgacg acgctcgcgc caagccggcc       180
     aacgcaaacg acgaggacgc cgacgaccac ggcgacgacg gcgacggagg cgtccccttc       240
     cccgagctga cccgcccgcg caggtccacc tcgctcctgt ccacgcgcgt cgtcatccac       300
     ccgaaccatc gccccgaggt cgtcgcgcgc gacctcgcgt ggtccccgct cggcctcgcg       360
     ccgccagctg tgtcgccgtc cggcatcctc ggcgacgggt gcctgctcgc catcgcatcc       420
     tccgcgcacc gcgtcaccgt gcacgccccg ccgcgcgccg agtccgacgc ggagtgggcc       480
     aaggtgtgcg acgtctcgga gatgttcgcg tccgtcgccg aggcggaggg gtggctggac       540
     gacggcggcg acgccttcga ccgatcggcg tttgagacca atcggcgtcc gaggttgcca       600
     tcgccgcagt acgcgcggct cctcctccgc gcgagggagg cgccgctcgc gctgccggcg       660
     gtcgccaacg gcggcggagg gcggggcgag aagcgtacgg cgctgcccgc ggcgggcgtc       720
     ggcgagggct cgagcggcgg cggcggcggc ggctgctggc cgaccgagcc ggcgaagttc       780
     ccggcggatt ctctccgcgt cggcgcggcg gtggaggttc ggcgtcgggc gtcgtcgggt       840
     gccgactcga ggggtgccga ctcgggtgcc gcgggtggat ggcgcccggg gacggttcag       900
     tcgctcgtgt ccgcgttcaa cttccgcgtg agggtttgtt tcgacgagcc cgttcgcggg       960
     gctccgcgat gcgtctggct cgtctgcgaa aacgacggcg agttcccggc gctgcgcctc      1020
     gacggcgagg gagcgagcgc cgcgggatgc cacgagttcc cgtcgcagtc cctcgggttc      1080
     gagggtgcgt cgggcgtgtt tgagctgcgg cccgcgcaga gtgggtggaa ggatggggtg      1140
     gtgggagaag ctgaggtggc gatgacgcga cgcgggggtt gggttccggc attcgtcgac      1200
     aagggcggcg cgtggatcaa gcttggggtg cgaggggaag gcgagcgctc gaacgtgccc      1260
     ccgggcacga tccgatcgag gccgaggatg gcgtggatcg gcgaggggtg cgcgcacggc      1320
     gcgtggagaa aagccacaga ctctgactac tccgggtaca agttgtcgga ctttacgttc      1380
     cccgaggatg aagaggacga tgaagaggat gaggatgagg agggggagga ggataaggag      1440
     ggggaggagg accccgtggc cccgaagccc gaaccgacgg tcgccaaggt gacgatcccg      1500
     aaggagactg acgtcgtcga gaaggaggag ctgcccgacg cggcgcccgt cgccgtcgcc      1560
     caccgacccg ccgcctccgc gactggaaag acgagaggca ggaaacctgg ggagcacttc      1620
     gccgcggctt acgcgaacga acttcgcgcg agtgccaagg ctgccgcggc gaagaccgcg      1680
     gccgagtgcg gcgcgaatga tgccccggtc aaagccgtgg aggcggtgtt cacggcggcg      1740
     aaggttggcg acgacgtctt tgccgccgtc aacgacgtca ccaaagcgaa caagtcgagg      1800
     cgtaacgcgg gtctcaagga catcgcgctg cgagtctgcg acgcgtttct ggctgcacgg      1860
     gcgggcgcgg ggatcacgag actctatcca caggggaaac acctcgacaa gaatgacgac      1920
     aagccgcttc tggagaaggt tgagaagctg gtttgggaga aggtcgcccc gcgcgtgcag      1980
     aagaacaagg acaaggtcag gaaggagctc aagccgccca cgcagaacgg gtaccagttg      2040
     gagatcaggg agaatatcac ccaggctgac gacaacgacg aggaggagga cgtgcccatc      2100
     gcgaggcggg cgagagccgc cagggcgaga cccatcctcc ccgccgacga ggacgaggac      2160
     gaggaggacg acgaggacga cccggatgcc tcgaacgcct cttccagcga cgacgacgag      2220
     gaggacgacg acgagcccaa gcccaagaga cagcgcggtc gcagggcttc gatcaccgcc      2280
     gcctcgagcg cggaccccgc gagcgccgcc gccgccgcga ggcgcgccgc cgccgccgcc      2340
     gcgctctccg tcgcgtggtc tccgcggctc gatcgccgtc ccgacgagcc ccccgcgtcc      2400
     gtgctagccg tggggtgcaa atccggcgcc gtcaccctgt ggctcgttcg gcggccggcg      2460
     acggcgggcg acgggggcgc ggtggacgtt gaggcgatgg gtcgctttcg cgcgtgcgac      2520
     gggtgcgcga cgtcgctggc gtggaccggg gacgtccggc tcggtgagtc accgcccggt      2580
     gagtcaccgc aaaacggtga gtcaccgcaa aacggtgagt catcgcccgg tgagtcaccg      2640
     gggggcgggg ggttcgcgct cgtcgtcggc ggctcggacg gatccgttcg aacgttcacc      2700
     gtctcgcgca aatccctcct cgccgccgcg ggtgccgagg ggggacgacg gggaaggcga      2760
     gcgacccgcg cggttcccct aactcccggc gcggagctgt ctccggcgga tggggatccc      2820
     gtgacgcgcg tcgccgtcgc cgactcggtt aagatcgatt cggacaatcg cgcacacgcg      2880
     cgaccggtga tcgccgcggg gaaggcctcg ggaacggtcg ccgcgtggcg cctcgccgcg      2940
     cacgactcca cgtccgcgga ggcgacgtgg agcgccaggt gtcacgtcca gccggtgtcc      3000
     gggctggcgt ggtgcgctgc tcccgagatt gagaactgcg ccgcggtccg gctcgtctcg      3060
     atgcacacca ccggcgccgc cgtcgcgtac accgtgccca cggacccgcg cgcgaggcac      3120
     gacgactgga cgctgacgga cgcctgcgtg gaggacttga cggtcgcgtc gattgacggt      3180
     ttggatttga acgggaacac agctggcggc ggcgcgaagc ttccggtttc atcgcacgcc      3240
     ggcctcgcgt cgtcccccgc gggcgttctg gtcgcgaccg ccgccggatt cgtcgccagc      3300
     acgtacgcga gcggagcgac gatgatacag tcgcgcgcga ggcggggacg cgtcgcggtg      3360
     gcgccgcccg cggcgctggc ggcgggtcgc gtcaaatcgc attcgatgac ggaaatttcc      3420
     ggggacgccg cgtcgggaaa actcgacgac ggcgctgccg acgagtcgct ctccgtcgcg      3480
     tgcgccgcgc ggcgcctccc gttcctcgcg tccgaccggg gcgtctcgct gtgggacgtc      3540
     agggccgcgg cgaagcacgc gggcgcgggc ggggcgaggg cgttggagtc cgccgcgggc      3600
     gagatgcaat caaccggggg cgctcgagcg tcgcagctcg caaagtctct tttatgcggg      3660
     gcaccggaaa tgtttgtagg gttcgagccg ctgtcgtgcg aagggtgcgg gcgagggtac      3720
     ccccgcgggg agggctggcc gggttgcggg gattgcggcc tgctgctgcg ccccgaggac      3780
     gtgacgcgcg cggcgctctc gagggcgatg atctga                                3816
//

If you have problems or comments...

PBIL Back to PBIL home page