(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE38

MICSR_1.PE38         Location/Qualifiers
FT   CDS_pept        complement(78458..79255)
FT                   /codon_start=1
FT                   /gene_family="HOG000100016" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636043"
FT                   /orf_name="MICPUN_56611"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62048.1"
FT                   /db_xref="HOGENOM:HBG560174"
FT                   /db_xref="UniParc:UPI000199AB2D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R5"
FT                   /transl_table=1
FT                   /translation="MMDNKVHISDGTTGRMPSAKSNKNHLFGHAIAEDLVRRYFSRSLD
FT                   KKDKVGLAAFGMHVLCHPPERRVLKLCYLCELMAVIAGLVMFFSSYLLRFDATSTFGIM
FT                   GAFFANVSLMCNLCGIINCLFMGFKISTGKGSVYEALDVLQGVGQTVNLIVFGVNGAGM
FT                   AYMFYSLDLTTDDYLRWANLGIFIPAFCYSYGFVIWYVLSYEPLSWWHQWSWNYELFKP
FT                   MYIIAWLRMGRVPMRERAAAQLEYLLADLPDDVMAILKADGNV"
     atgatggaca ataaggttca catctctgat ggaacgactg ggcgcatgcc ctcggctaaa        60
     tccaacaaaa accacctgtt cggtcacgcg attgcggaag acctcgtgcg ccggtacttc       120
     tctcggtcgc tcgacaagaa ggacaaggtt ggtctcgccg cttttgggat gcatgtactg       180
     tgccacccac ccgagaggcg cgtgttgaag ctttgctatc tttgcgaact catggccgtg       240
     atcgcgggtt tggtgatgtt cttcagttct tacttgcttc gattcgatgc tacctcaacc       300
     tttggcatca tgggcgcatt cttcgccaac gtttcgctga tgtgtaacct atgtgggatc       360
     ataaactgct tgtttatggg cttcaagatc agcaccggca aggggtcggt atacgaggcc       420
     ttggatgtgc tgcaaggggt tgggcagaca gtgaacctga tcgtattcgg tgtcaatggt       480
     gcagggatgg cttacatgtt ctactccctc gacctcacga ccgatgacta cctgcgttgg       540
     gccaaccttg ggatcttcat cccggcgttc tgttactcgt atggttttgt tatatggtac       600
     gtgctttctt acgagccgtt gtcgtggtgg caccagtggt cgtggaacta cgaattgttc       660
     aaacccatgt acatcatcgc ctggcttcgg atggggaggg tgcccatgcg ggagagagcc       720
     gcggcgcaac tcgagtactt gctggcggat ctgcccgacg acgtgatggc gatcctcaaa       780
     gccgacggga atgtgtag                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page