(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE380

MICSR_1.PE380        Location/Qualifiers
FT   CDS_pept        741564..742499
FT                   /codon_start=1
FT                   /gene_family="HOG000030427" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637010"
FT                   /orf_name="MICPUN_97151"
FT                   /product="Predicted protein"
FT                   /function="aminopeptidase activity"
FT                   /function="metalloexopeptidase activity"
FT                   /biological_process="cellular process"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO61782.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008235"
FT                   /db_xref="GO:0009987"
FT                   /db_xref="HOGENOM:HBG299384"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="UniParc:UPI000199A91C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q7"
FT                   /transl_table=1
FT                   /translation="MPEFKWTGPLRPMKVSPKRSVPKIGWLCPLPDYARTGWPEAEFAS
FT                   SLQHKLEVKTPEQLAKMRAACSLGRAVMDAVAAAIKPGVTTDQLDRICHAMTLMNGAYP
FT                   SPRNYMGFPKSLCTSVNEVVCHGIPDARPLEDGDIVNLDITVCLDGYHGDLNETYFVGT
FT                   GSSDPERAERAKALMKCALECLELAMARCTPGARFRDLGEAIQTHANGRGYGVVKDFCG
FT                   HGIGALFHCAPNVPHYAKNKAVGVMKPGMTFTIEPMVNEGTHRTKHWPDGWTAVTADGG
FT                   RSAQYEHTMAVTETGLDVLTKRTANSRPFY"
     atgccggagt ttaagtggac cgggccgctg cgtccgatga aggtgtcgcc caagcggtcg        60
     gtgcccaaga ttgggtggct gtgcccgctc ccggactacg cgcggaccgg ctggccggag       120
     gctgagttcg cctcgtccct gcagcacaag ctggaggtaa agacgcctga gcagctggcc       180
     aagatgcgcg cggcgtgttc gctcgggcgg gccgtcatgg acgccgtcgc cgccgccatc       240
     aaacccggcg tcaccaccga ccaactcgac aggatatgcc acgcgatgac cctgatgaac       300
     ggcgcgtacc cgtccccgag gaactacatg ggcttcccca agtctctgtg cacctccgtg       360
     aacgaggtgg tgtgccacgg cattccggac gcgcggcccc tggaggatgg ggacatcgtc       420
     aacctggaca taaccgtgtg cctcgacggg taccacggtg acctgaacga gacgtacttc       480
     gtcggaaccg gaagttccga cccggaacgc gccgaacggg ccaaggcgct gatgaagtgc       540
     gccctggagt gcctggaact cgcgatggcg cggtgcacgc ccggcgcgcg gttcagggac       600
     cttggcgagg cgatacagac gcacgccaac ggacgggggt acggcgtggt gaaggacttt       660
     tgcggtcacg gcatcggggc gctgtttcac tgcgccccga acgtcccgca ctacgccaag       720
     aacaaggctg tcggggtgat gaagcccggg atgacgttca cgatcgagcc gatggtgaac       780
     gaggggacgc acaggacgaa gcactggccg gacgggtgga cggcggtgac ggcggatggc       840
     gggcggagcg cgcagtacga gcacaccatg gcggtgacgg aaaccggcct ggacgttctc       900
     acgaaacgca ccgcaaactc gcgcccgttc tactga                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page