(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE381

MICSR_1.PE381        Location/Qualifiers
FT   CDS_pept        complement(742671..743453)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637011"
FT                   /orf_name="MICPUN_107914"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62211.1"
FT                   /db_xref="UniParc:UPI000199A91D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q8"
FT                   /transl_table=1
FT                   /translation="MALPQCLSKDKASKLRGQENMAINSSAYQFFGTLFNVIGLAMGIV
FT                   GSLMYSPTVLHAMFGADMNENREWEWMRNWANIIWAVSFFMFPIGVGMFLVERWECISA
FT                   HNEAVGKPPPSPWDKNMRILVWAEIMLGICAAGGVFFCFDDDPGAYFIACALFTLAGGI
FT                   KVSLLVYEICEMSGCCCGTGVFDEEHGMPAKGADEKTPLLNDGDGYPVGGGNWKGEQGS
FT                   AGKGRRDSTGSPQGSDIAPSSDTSSLLGDPHVAQGSPR"
     atggccttac cgcagtgcct cagcaaggat aaagcatcca agctccgcgg acaggagaac        60
     atggccatca acagctcggc gtaccagttc ttcggtaccc tcttcaacgt gatcggtctc       120
     gcgatgggga tagtcggttc gctcatgtac tcgccgacgg tgctgcacgc gatgttcggc       180
     gcggacatga acgagaaccg agagtgggag tggatgcgca actgggcgaa catcatctgg       240
     gcggtgtcct tcttcatgtt ccccatcggc gtcgggatgt tcctcgtgga acgatgggag       300
     tgcatcagcg cgcataacga ggcggtgggt aaacccccgc cgtcgccgtg ggacaagaac       360
     atgcgcatac tggtctgggc ggagatcatg ctcgggatct gcgcggcggg tggcgtcttc       420
     ttctgctttg acgacgaccc gggggcgtac tttatcgcgt gcgctctctt caccctcgca       480
     ggtgggatca aggtgagctt gctggtgtac gagatatgcg agatgtccgg gtgctgctgc       540
     gggaccggcg tgttcgacga ggagcacggg atgccggcga agggggcgga tgagaagact       600
     ccgctgctca acgacggcga cgggtacccg gtcggcggcg ggaattggaa gggcgagcag       660
     ggctccgccg ggaagggtcg cagggacagc acggggtcgc cgcagggcag cgacatcgcg       720
     ccgtcttcgg acacgtcctc gctcctggga gaccctcacg tggcccaagg ctcgccgcgt       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page