(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE382

MICSR_1.PE382        Location/Qualifiers
FT   CDS_pept        744189..746138
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637012"
FT                   /orf_name="MICPUN_56961"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61783.1"
FT                   /db_xref="InterPro:IPR021897"
FT                   /db_xref="UniParc:UPI000199A91E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q9"
FT                   /transl_table=1
FT                   /translation="MDDRSRETAVDVVRRCREAGIELDPVLAAYHCAALRYQGVPWDDA
FT                   FTQTAAERIVAPRSRLAVDTMAMQVAADEIRATMTAAIAADRRDREERAAAYEREVLTV
FT                   AASFPRMTQREQADFMEHMWKNVFFRYVCVKGGMESALGINDEVGREETFAAFKSVFPK
FT                   HETTRFLTQTAPEISAQLRELASIVLGIRVFNRRMEELSRGGNGPSPSGSVPDPAPGYL
FT                   NLGAKMREDLAGRAHSAARLCAQYRCVSSHQSLRRDPGDELLTRLADENNNRVAYWSII
FT                   RALIEDNAEGIERVDELTRRVHDGCEEVRELIEDAEGLTEGLGGGVRRDELYPILQSVG
FT                   ANHSALLDEAAAQEVIHAVSARMTDFSKPFETSLTNELLHEGIRVEKMAKERYGPHAVV
FT                   GVPKVDDAKDVPKTVVEPHLSRKLGESGAEITHGGVTTLEYGGYDVFALCKRRGLALPA
FT                   SMSAPDTAVVFQGKTYGFADEYAAKQFASQPAKYVRAMHATLFRMPELVRITHPSGEAT
FT                   ARAFPNLDVAKLAAGMSVPSPTEFGTQTDTHPVERHVDKDYEWNEWALRRRALHAANLL
FT                   RKATHGSQTHSSHFRRENTTQVWLPKRNETQTVVTKGTTMPQKKRYIGGMRGAPDVKLN
FT                   VVNVELDLGQPYEH"
     atggacgacc ggtctcgtga gacggctgtg gacgtcgtgc gccgatgccg cgaggcgggc        60
     atcgagctcg atcccgtcct cgccgcgtac cactgcgcgg cgctcagata ccagggcgtg       120
     ccgtgggacg acgcgttcac gcagacggcc gccgagcgca tcgtcgcgcc caggtccagg       180
     ctcgcggtgg acacgatggc catgcaggtc gccgcggacg agatccgcgc gacgatgacc       240
     gccgcgatcg ccgcggatcg ccgcgaccgt gaggaacgcg ccgccgcgta cgagcgcgag       300
     gtcctcaccg tcgccgcgtc cttcccccgc atgacgcagc gcgagcaggc tgacttcatg       360
     gagcatatgt ggaaaaacgt cttcttccgg tacgtgtgcg tcaaaggggg gatggagagc       420
     gctctgggga tcaacgacga ggtgggacgg gaggaaacgt tcgcggcttt caagtcggtg       480
     tttccaaagc acgagacgac gcggttcctg acccagacgg cgccggagat cagcgcgcag       540
     cttcgcgagc tcgcgtccat cgtgctgggc atccgagtgt tcaaccgacg gatggaggaa       600
     ctctcgcggg gggggaacgg gccgtcgccc agcggctcag tcccggaccc ggcgccgggg       660
     tacttgaacc tcggcgcgaa gatgcgagag gacctcgcgg gcagggcgca ctcggcggcg       720
     aggctgtgcg cgcagtaccg ttgcgtctcg tcgcatcaat cgcttcgaag ggaccccggg       780
     gatgagttgc tcacgcggct cgccgacgag aacaacaacc gcgtcgcgta ctggtccatc       840
     atccgcgccc tcatcgagga caacgcggag ggtatcgagc gcgtggacga gctgacgcgg       900
     agggtgcacg acgggtgcga ggaggttcgc gagctgatcg aagacgcgga gggtttaacc       960
     gagggtttag gcggcggcgt acgaagggac gagttgtacc cgatcctgca gtcggtgggt      1020
     gcgaaccact ccgcgctgtt agacgaggcg gcggctcagg aggtaatcca cgcggtgagc      1080
     gcgcgcatga cggacttttc gaaacccttc gagacgtcgc tcacgaacga gctcctccac      1140
     gagggcatcc gggtcgagaa gatggcgaag gagcggtacg ggccgcacgc cgtcgtcggg      1200
     gttccaaagg tggacgatgc caaggacgtc cctaagacgg tcgtggagcc gcacttgagt      1260
     cgtaagctcg gcgagtccgg cgcggagatc acgcacggag gcgtgaccac cttggagtac      1320
     gggggatacg acgtcttcgc gctgtgcaaa cgacgcggct tggcgctgcc cgcgtcgatg      1380
     tcggcgcccg acaccgcggt tgttttccag ggcaagacgt acggattcgc ggacgaatac      1440
     gccgccaagc agttcgcgtc gcagccggca aagtacgtgc gcgcgatgca cgcgacgctg      1500
     tttcgcatgc cggagctggt gcggatcacc cacccctcgg gggaggcgac ggcgagggcg      1560
     tttccgaatt tggacgtcgc caagctggcg gctgggatgt ccgtgccgtc gcccacggag      1620
     tttggcacgc agacggacac gcacccggtg gagcgtcacg tcgataagga ctacgagtgg      1680
     aacgagtggg cgctgcggcg acgggcgctg cacgcggcca acttacttcg caaggcgacg      1740
     cacggctcgc agacgcactc gagtcacttc aggcgggaga acaccactca ggtttggctc      1800
     ccgaagagga acgagacgca gacggtggtg accaagggga cgacgatgcc gcagaagaag      1860
     aggtacatcg gcggcatgag gggcgcgccg gacgtcaagc tcaacgtggt caacgtggag      1920
     ctggacctcg gccaaccgta cgagcactag                                       1950
//

If you have problems or comments...

PBIL Back to PBIL home page