(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE383

MICSR_1.PE383        Location/Qualifiers
FT   CDS_pept        complement(746990..747214)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637013"
FT                   /orf_name="MICPUN_107915"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62212.1"
FT                   /db_xref="UniParc:UPI000199A91F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R0"
FT                   /transl_table=1
FT                   /translation="MLRTMLSICLPVLKFSARALGLTKTEMDPNARTIEDPVRARPDFT
FT                   PILTLLHLRSTRSPRPLSCTLCPLLRNAC"
     atgctgagaa ctatgctgtc catatgcctt ccggtcctca agttttccgc gcgagctctc        60
     gggctcacca agactgagat ggacccgaac gcgaggacca tcgaggatcc ggtgcgcgcc       120
     cgccccgatt tcaccccgat actgacgctc ctccacctgc gaagcacccg ctcccctcgt       180
     cccctctcgt gcacgctctg ccccttgctc cgtaacgcat gctga                       225
//

If you have problems or comments...

PBIL Back to PBIL home page