(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE384

MICSR_1.PE384        Location/Qualifiers
FT   CDS_pept        747474..>748358
FT                   /codon_start=1
FT                   /gene_family="HOG000030425" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637014"
FT                   /orf_name="MICPUN_79723"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61784.1"
FT                   /db_xref="HOGENOM:HBG318431"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="UniParc:UPI000199A920"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R1"
FT                   /transl_table=1
FT                   /translation="MSSTWNKLVNLVIRPPRAQYDPNEHLPGPRFRIAGVTHVRRDIDL
FT                   AGADGLTLKCSHYEPEVRGNDPLPCVIYLHGNSGSRCDATEAIRLLLPARITVFAVDLG
FT                   GSGMSEGEYVTLGVRETKDVECIVNHLRDQGLTSKIGLWGTSMGAVTAIMYANRDPSIA
FT                   GVVLDSPFSSLPKLMLELVAQFTKGSRVGVPKMAARMALSFVRSSVKSRAKFDINDLDL
FT                   RKVAPSTFCPALFAHGKDDDFIPPHHSETLHELYAGDKNYIAIDGDHNSPRPAFFFDST
FT                   VIFFCNVLDPPPTS"
     atgtcgtcga cgtggaacaa gctcgtcaac ctcgtcatcc gcccgcctcg cgcgcagtac        60
     gacccgaacg agcacctccc cgggccgaga ttccgcatcg ccggggtcac tcacgttcga       120
     cgcgacatcg acctggcggg agccgacggg ctgacgctca agtgcagcca ctacgagccc       180
     gaggtgaggg gcaatgaccc gctgccgtgc gttatctatc tccacggcaa ctcggggtcc       240
     cgatgtgacg ccacggaggc catacgtctg ctcctccccg cgcgcatcac cgtgttcgcg       300
     gtggacctcg ggggatccgg catgagcgag ggggaatacg tgacgctcgg cgtccgggag       360
     acgaaggacg tcgagtgcat cgtcaaccac ctcagggacc aggggttgac ctccaagatc       420
     ggcctctggg gtaccagcat gggcgcggtg accgccatca tgtacgcgaa ccgcgacccc       480
     tccatcgccg gcgtcgtcct cgactcgccg ttttcttcgc tgcccaagct catgctcgag       540
     ctcgtcgcgc agttcaccaa gggcagccgc gtgggcgtgc ccaagatggc cgcgcgaatg       600
     gcgctctcct tcgtcagatc ttccgtcaaa tcgagggcca agttcgacat caacgacctg       660
     gacctgagaa aggtggcgcc gtccacgttt tgcccggcgc tcttcgcgca cggcaaagac       720
     gacgacttca taccgccgca ccacagcgag acgctgcacg agctgtacgc cggggataag       780
     aactacatag ccatcgacgg cgaccacaac tcgccgagac cggcgttctt cttcgacagc       840
     acggtgattt tcttttgcaa cgtgctggac ccgccgccga cgagc                       885
//

If you have problems or comments...

PBIL Back to PBIL home page