(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE387

MICSR_1.PE387        Location/Qualifiers
FT   CDS_pept        752397..753743
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637017"
FT                   /orf_name="MICPUN_99477"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61785.1"
FT                   /db_xref="UniParc:UPI000199A98A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R4"
FT                   /transl_table=1
FT                   /translation="MRRQAEERRAVVLTNTEKDMLKELSEARKGTWNNTLEAQRKQREA
FT                   AKAQRLEDEEEAKCVLDREEASIRATQRQAQIMRANKMLYDQTDRVKSFNSSLLLSDVL
FT                   QERDLQIDLKKRVEEVRDRHEAAFVKEQEKAWEVADYAEAAKASERKQAAMQQRDAQLL
FT                   QIEQFKEQILAEMREDRRDGELIRRRAAEEEEEERLRELRRREEAMRGAMETAKANAAL
FT                   KEYKAGEAAAEAAMDRKIEQFARAKERMDAARRVHAEAKNREKAAVRDAMVARMEADLI
FT                   ARQKKAVEAEDNAAERAEAEREAAEALKAAERLEDLRVIELSRQQQLAIKAAERERERE
FT                   REELFVRQWAQRNEQLQREEEEEKLETFARNKRLQQAHVRQIARKIKKANAERELDLRA
FT                   SLAATRRLEEEDELFDHYARVCMDEWESRGKSLRPMMVELGKFDPNRVT"
     atgcgcaggc aggccgagga gcgtcgcgca gtcgtcttaa ccaacaccga gaaggatatg        60
     cttaaagaac tcagcgaggc tcgcaagggc acctggaaca acaccctcga ggcgcagcgg       120
     aagcagcgag aggcggccaa ggcgcagagg ctcgaggatg aggaggaggc caagtgcgtc       180
     ctggaccgcg aggaggcttc catccgcgcg acgcagaggc aggcgcagat catgcgcgcg       240
     aacaaaatgc tctatgacca aaccgacagg gtcaaatcct tcaactcctc gctcctgctc       300
     tccgacgtcc tgcaagagag ggacctccag atcgacctca aaaaacgcgt cgaggaggtc       360
     cgcgaccggc acgaagccgc gttcgttaaa gagcaagaga aggcgtggga ggttgccgac       420
     tacgcggagg cggccaaggc gagcgaacgg aaacaggccg cgatgcagca gagggacgcg       480
     cagctcctcc agatcgaaca gttcaaggag cagatcctcg ctgagatgcg cgaagatcgt       540
     cgcgacggcg agctcatccg aaggcgcgcc gccgaggagg aggaggagga gcgcctgagg       600
     gagctgcggc ggcgcgagga ggcgatgcgc ggcgcgatgg agaccgccaa ggctaacgcg       660
     gcgctcaagg agtacaaggc tggcgaggct gcggcggagg cggcgatgga ccgcaagatt       720
     gagcagtttg cgcgcgccaa ggagcgaatg gacgccgcga ggagggtaca cgcggaggca       780
     aagaacaggg agaaggcggc ggtgcgcgac gcgatggtgg cgcgcatgga ggctgacctc       840
     atcgcgcggc agaagaaggc ggtggaggcg gaggataacg cggcggaacg cgcggaggct       900
     gagcgcgaag ccgcggaggc gctgaaggct gccgagcgcc tggaggacct gcgcgtcatc       960
     gagctctcgc gccaacagca gctcgcgatc aaggctgcgg agcgcgagcg cgagcgcgag      1020
     cgcgaggagc tcttcgtgcg gcaatgggcg cagcgcaacg agcagctgca gcgcgaggag      1080
     gaggaggaga agctggagac gttcgcgagg aacaagcggc tgcagcaggc gcacgtccgc      1140
     caaatcgcga gaaagatcaa aaaggcgaac gcggagcgcg agctggacct gcgggcgtcg      1200
     ctggcggcga cgaggcgtct ggaggaggag gacgaactgt tcgatcacta cgcgcgcgtg      1260
     tgcatggacg agtgggagag caggggaaag agcctccggc cgatgatggt ggagctcggc      1320
     aagttcgacc cgaatcgtgt cacttga                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page