(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE388

MICSR_1.PE388        Location/Qualifiers
FT   CDS_pept        join(754190..754322,754463..755478)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637018"
FT                   /orf_name="MICPUN_56966"
FT                   /product="Predicted protein"
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO61786.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="InterPro:IPR001092"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="UniParc:UPI000199A98B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R5"
FT                   /transl_table=1
FT                   /translation="MDDHPGGLAPLFDDAGKDRTYTDTELQELLSFVENMDNATSADEL
FT                   AGGLNHVGLGLAPANAGLSHPVPHAPVLPMRFNEQGISLQFQPGPTSARGRGRGGRGGG
FT                   RGAAPAVGNFEAPMSASPAIEDDGSQRVSHGASEKQRRDRINAMIDELRMLVPGQAGGG
FT                   EGRRSKYIVLQDTINMIAALKAKCQAQERELVALRAAGASEGASGGVQTQDQQQQMMML
FT                   MGQDGQGLDPVREESIRNPANGTNSTLNSGQTISVAVEMGEEICYVKIKAPDRQGLLQD
FT                   ILNALHALPMTVQRAVVTTDSENGVVFVTDIFELKINTAIPVEQRISPEDVKTHIHQSM
FT                   HASFLAYENPELYARKRKGTQGGVSGSDSGGSGIGSGVRAAG"
     atggacgacc accccggcgg gctggcgccc ctgttcgacg atgcgggcaa ggatcgaacg        60
     tacacggaca ctgagctcca ggagcttctc agcttcgtgg aaaacatgga caacgcgacg       120
     agcgcggacg aactcgctgg tgggctgaat catgtcggcc tcggcctggc tccggcaaac       180
     gccggcctga gccacccggt tccccacgcc cccgtccttc ccatgcggtt caacgagcag       240
     ggaatcagcc tgcagtttca acccggaccc acgtcggcgc gcggacgcgg ccggggcggg       300
     cgcggcggtg gtcgcggcgc cgcccccgcg gtcggcaact tcgaggcacc catgtctgcg       360
     tcgcccgcga tcgaagacga cggctcgcag cgggtgagcc acggtgcgag cgagaagcag       420
     cggcgcgatc ggatcaatgc gatgatcgat gaactccgga tgctggtccc gggtcaggcg       480
     ggtggagggg aggggaggcg gagcaagtac atcgtgctgc aggacacgat taacatgatc       540
     gccgcgctga aggcgaagtg ccaggcgcaa gagcgcgagc tcgtcgcgct gagggccgcc       600
     ggcgcctccg agggggcctc gggtggggtg caaacgcagg accagcaaca gcagatgatg       660
     atgctgatgg ggcaggatgg gcagggtttg gacccggtgc gcgaggaatc gatccgaaac       720
     cccgcaaacg ggacgaattc aacgctcaac agcgggcaga cgatcagcgt ggcggtcgag       780
     atgggcgagg agatttgcta cgtgaagatc aaggctcccg accgccaggg cttgctgcag       840
     gacatcctca acgcgctgca cgcgctgccg atgacagttc aacgcgctgt ggtcaccacg       900
     gacagcgaga acggcgtggt gtttgtcacc gacatcttcg agctcaagat caacaccgcc       960
     atcccggtcg agcagcgcat ctcaccggaa gatgtcaaga cgcacataca ccagtcgatg      1020
     cacgcgtctt tcctcgcgta cgagaacccc gagctgtatg cgcggaagcg aaaaggaacg      1080
     cagggcgggg tgtccggttc ggattccgga ggctccggga tcggctcggg ggtcagagcg      1140
     gccggctga                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page