(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE389

MICSR_1.PE389        Location/Qualifiers
FT   CDS_pept        complement(<755725..>756288)
FT                   /codon_start=1
FT                   /gene_family="HOG000242591" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637019"
FT                   /orf_name="MICPUN_72375"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62215.1"
FT                   /db_xref="HOGENOM:HBG317622"
FT                   /db_xref="InterPro:IPR008501"
FT                   /db_xref="InterPro:IPR018018"
FT                   /db_xref="UniParc:UPI000199A98C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R6"
FT                   /transl_table=1
FT                   /translation="EEALIKKRLLTQTTTARPGADPPVKKLTKKYVAYVNALAEDDANG
FT                   DGADAERAREAWLKEIALYEFNMGRYRAVASANAREMEQYASASAAVDGEVRGTKDEIA
FT                   ELKTDLDGARLDRQHKEEYEALRRLCTQFPSRSDTTARLASLEAEIAELETESEATASK
FT                   LDLRKKQFALLLHLVNELQGELAEE"
     gaggaggcgc tcattaagaa acgcctcctc acgcagacca ccaccgcgag acccggcgct        60
     gacccgcccg tcaagaagct taccaagaag tacgtcgcct acgtcaacgc gctcgccgag       120
     gacgacgcga acggggacgg cgccgacgcc gagcgtgcga gggaggcttg gctcaaggag       180
     atcgcgctgt acgagttcaa catggggcga taccgcgcgg tcgcgtcggc gaacgcgcgg       240
     gagatggagc agtacgcgag cgcgagcgcc gcggtggacg gcgaggtgcg cggcaccaag       300
     gatgagatcg cggagctcaa gacggacctc gacggcgccc ggctcgaccg acagcacaag       360
     gaggagtacg aggccctgcg ccggttgtgc acgcaattcc cgagcaggtc ggacaccacc       420
     gcgcggctgg cgtcgctcga ggcggagatc gccgagctgg agacggagtc ggaggcgacg       480
     gcgtccaagc tcgatcttcg caagaagcaa ttcgcgctgc tcctgcacct ggtgaacgag       540
     ttgcaagggg agctcgcgga ggag                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page