(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE39

MICSR_1.PE39         Location/Qualifiers
FT   CDS_pept        79459..79935
FT                   /codon_start=1
FT                   /gene_family="HOG000029296" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636044"
FT                   /orf_name="MICPUN_107856"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61603.1"
FT                   /db_xref="HOGENOM:HBG638995"
FT                   /db_xref="InterPro:IPR007263"
FT                   /db_xref="UniParc:UPI000199AB2E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R6"
FT                   /transl_table=1
FT                   /translation="MNRRDEPGASTSSSSTLVALVDGDCALCSGYARLVSALDGKGAVY
FT                   FETQQSDAGRALLKRCGMPTDLSSIVVVEVSPKGKAVGYVRSTAVLRTFLALGAPWSAL
FT                   YLTVAIPEFIRDGVYGLVAKHRYSVFGTNGGRCALPDAVTRRRIGRVLPAGLLD"
     atgaaccggc gggacgaacc cggcgcgtcc acgtcttcct cgtctaccct cgtcgccctc        60
     gtcgacggcg actgcgcgct gtgcagcggc tacgcgcgtc tcgtctccgc gctcgatggc       120
     aaaggcgcgg tgtacttcga gacgcagcag agcgacgcgg ggcgggcgct gctcaagcgg       180
     tgcgggatgc ccacggacct gagctccatc gtggtcgtcg aggtgtcacc caagggcaag       240
     gcggtcgggt acgttaggtc cacggctgtg ctgaggacgt tcctggcgct cggggcgccg       300
     tggtcggcgc tctacctgac cgtggccatc cccgagttta tccgcgacgg ggtgtacggg       360
     ctggtggcca aacatcggta ctcggtgttt gggacgaacg gcgggagatg cgcgcttccg       420
     gacgcggtga cgcggcgacg gatcggccgc gtactccccg cgggcctgct agactag          477
//

If you have problems or comments...

PBIL Back to PBIL home page