(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE390

MICSR_1.PE390        Location/Qualifiers
FT   CDS_pept        756876..758516
FT                   /codon_start=1
FT                   /gene_family="HOG000040008" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637020"
FT                   /orf_name="MICPUN_93687"
FT                   /product="Phosphoglucomutase/phosphomannomutase family
FT                   protein"
FT                   /function="intramolecular transferase activity,
FT                   phosphotransferases"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO61787.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016868"
FT                   /db_xref="HOGENOM:HBG287074"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="UniParc:UPI000199A98D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R7"
FT                   /transl_table=1
FT                   /translation="MVTTQFIPHATAAEDGTPVLVTTTTPAILKKLQNGSDVRGVALEG
FT                   VPGEPVTLNEEAAYLIGAAFVDWLADKKGKKPSELSIAVGRDPRLSGPALANAMFAGFG
FT                   SKDVGRVVDMGIATTPACFMATVTPGVAYDAGIMLTASHLPFNRNGAKFFTSDGGLDKA
FT                   DIKRICEDAAAACQAAPDGHAIPLDGDDAVESVPFLEDYAAQLRDLIKKGANHPTAYDE
FT                   PLTGMKIIVDAGNGSGGFFAKSVLEPLGADVYGSQFLDPDGKFPNHSPNPEDAEAMDSA
FT                   VEATVKAKADLGVIFDTDVDRSAVIDGDGNPINRNKLIALLAAIILDEHPGSTVVTDSV
FT                   TSDGLAEFIEGKGGKHVRYMRGYKNVINEGVRRDKAGEPCHLMIETSGHGAMKENYCLD
FT                   DGAYIAVKIIIEAVRRRLSGGKGISDLLSELREPLEEKEVRLKITCDDFKAYGGDVLEQ
FT                   LKEAVGSMKGYTPVDVNYEGYRVNRDEGDGKRGWFLLRQSLHDPVMVLNFESEIPGGVD
FT                   AMAKDVVAWLKEKDFASLDASAVYAILDK"
     atggtgacga ctcagttcat cccacacgcc accgcggccg aggacgggac ccccgtcctc        60
     gtcaccacca ccacccccgc gatactgaag aagcttcaga acggatccga cgttcgcggc       120
     gtcgccctgg agggcgtccc gggcgagccc gtgacgctca acgaggaggc cgcgtacctc       180
     atcggcgccg ccttcgtgga ctggctcgcg gacaagaagg gtaagaaacc ctcggagctg       240
     tccatcgccg tgggccggga cccgaggctc agcggacccg cgctcgccaa cgccatgttc       300
     gcggggttcg gttccaagga cgtcggccga gtcgtggaca tgggcatcgc gaccacgccc       360
     gcgtgtttca tggccaccgt gacgccgggc gtggcatacg acgcgggaat catgctcacc       420
     gcgtcgcacc tccccttcaa ccgcaacgga gccaagttct tcacctccga cggcggcctg       480
     gacaaggcag acatcaagcg catctgcgag gacgcggcgg cggcttgcca agccgcgccc       540
     gacggccacg ccatcccgct ggacggcgac gacgccgtgg aatccgtacc tttcctcgag       600
     gactacgccg cccagctccg cgatctcatc aagaagggcg cgaaccaccc caccgcgtac       660
     gacgagcccc tcaccgggat gaagatcatc gtcgacgccg gcaacggcag cggcgggttc       720
     ttcgcgaaga gcgtgctgga gccgctgggc gccgacgtct acggctcgca gttcctcgac       780
     ccggacggta agtttccgaa ccacagcccc aatcccgagg atgcggaggc catggacagc       840
     gcggtggagg cgacggtgaa ggcgaaggct gacctgggcg tcatctttga cacggacgtc       900
     gatcgctccg cggtgattga cggagacggg aatccgatca accggaacaa gctcatcgcg       960
     ctcctcgcgg cgatcatcct cgacgagcac ccggggagca cggtggtgac ggacagcgtc      1020
     acttcggatg gactcgccga gttcatcgag ggcaagggtg gcaagcacgt gcggtacatg      1080
     cgcggttaca agaacgtcat caacgagggc gtgcgaaggg acaaggcggg cgagccgtgc      1140
     cacctcatga ttgagacgtc gggtcacggc gcgatgaagg agaactactg cctcgacgac      1200
     ggcgcgtaca tcgctgtcaa gatcatcatc gaggcggttc gtcgcaggct gagcggcggg      1260
     aagggcatct ccgacctgct ctccgagctg cgagagcccc tcgaggagaa ggaggtgcgg      1320
     ctgaagatca cctgcgacga cttcaaggcg tacggcggcg acgtcctcga gcagctcaag      1380
     gaggcggtgg gctccatgaa ggggtacact cccgtcgacg tcaactatga ggggtatcgc      1440
     gtgaacaggg acgaagggga cgggaagcgg ggttggttcc tgctgcggca gagcctgcac      1500
     gacccggtga tggtgctcaa ctttgaatct gagattccgg gcggagtcga cgcgatggca      1560
     aaggacgtcg tcgcgtggct gaaggagaag gacttcgcga gcctggacgc ctccgcggtg      1620
     tacgccatcc tggacaagtg a                                                1641
//

If you have problems or comments...

PBIL Back to PBIL home page