(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE391

MICSR_1.PE391        Location/Qualifiers
FT   CDS_pept        join(complement(759279..759330),complement(759082..759155),
FT                   complement(<758643..758957))
FT                   /codon_start=1
FT                   /gene_family="HOG000216624" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637021"
FT                   /orf_name="MICPUN_90249"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62216.1"
FT                   /db_xref="HOGENOM:HBG499888"
FT                   /db_xref="InterPro:IPR005326"
FT                   /db_xref="UniParc:UPI000199A98E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R8"
FT                   /transl_table=1
FT                   /translation="MLIPKKNRKEVYKYLFREGVIYAKKDFNLPAHPEIKEVPNLQVIK
FT                   LMQSFTSKELVKEQFSWRYYYWYLTNEGIEYLREYLNLSADVVPNTLKKSTRPPTRPMA
FT                   DERAPRGDRGPRGGREGYRSERPGGFGRGGDKAGPGGNFNPQF"
     atgcttattc ccaagaagaa ccgcaaggag gtgtacaagt acctcttccg tgagggcgtc        60
     atctacgcca agaaggactt caacctcccc gctcaccccg agatcaagga ggtccccaac       120
     cttcaggtga tcaagctgat gcagtccttc acctccaagg agctcgtcaa ggagcagttc       180
     tcctggaggt actactactg gtacctcacc aacgagggca tcgagtacct ccgcgagtac       240
     ctcaacctct ctgcggatgt cgtccccaac acgctgaaga agtctacccg cccccccacc       300
     cgccccatgg cggacgagcg cgcgccccgc ggcgaccgcg gtccccgcgg cggccgcgag       360
     ggctaccgct ccgagcgccc cggcggcttc ggccgcggcg gcgacaaggc gggccccggc       420
     ggtaacttca acccccagtt t                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page