(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE392

MICSR_1.PE392        Location/Qualifiers
FT   CDS_pept        complement(759802..760710)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637022"
FT                   /orf_name="MICPUN_107917"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62217.1"
FT                   /db_xref="UniParc:UPI000199A98F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R9"
FT                   /transl_table=1
FT                   /translation="MIGTSPVLVLYLAYTVMAGAFTLKLSSDCASSAPAPGVLEPPSPP
FT                   PPPSPPPGTAYVSSGETNYWEMASAVALGVAMISMSCTSFAAVYYMEDTVENKRKECEA
FT                   FPVDEEVEAREKKVQAKKHAYKAVTSWNALPKLDKCLLGASLFLMTLACHIAGNFGSLC
FT                   FATFSVTCSVALADVVLPLGWVAIGLFTAGCLTFYFYGKGASRRARKVLEAESNADMVT
FT                   ADAVTEIGGAIESGGRRGRGAVNAVEPAGTTAQDPARLPGAVTEQVTRAANWSDDETPP
FT                   GSVSSYGEEEDVEEGKPWDRM"
     atgatcggca cctcgcccgt gctcgtgctt tacctcgcgt acaccgtcat ggccggcgcg        60
     ttcacgctga aactcagcag cgactgtgcg tcgtctgctc cggctcccgg cgtcctcgaa       120
     ccgccgtcgc cgccgccgcc gccgtcgccg ccgccgggca cggcctacgt gagctccggc       180
     gagaccaact actgggagat ggccagcgcg gtggccctcg gcgtcgcgat gatctccatg       240
     tcctgcacct ccttcgcggc ggtgtactac atggaggaca ccgtcgagaa taagcgaaaa       300
     gagtgcgagg cgtttcccgt ggacgaggag gtggaggcgc gcgagaagaa ggttcaggcg       360
     aagaagcacg cgtacaaggc cgtgacgtcc tggaacgcgt tgccgaagct cgacaagtgc       420
     ctcctcggcg cgtcgctctt cctcatgacc ctcgcgtgcc acatcgcggg caactttggc       480
     agcctctgct ttgccacgtt ttccgtgacg tgctccgtgg cgctcgccga cgtggtgctg       540
     cccctcgggt gggtcgccat cgggctgttc accgcgggat gcctgacgtt ctacttctac       600
     ggcaagggcg cgtcgaggcg ggcgcggaag gtgctggagg ctgagtccaa cgcggacatg       660
     gtgaccgcgg acgcggtgac cgagattggc ggcgcgatcg agtcgggcgg gaggcgcggt       720
     cgaggcgcgg tgaacgcggt ggagcccgcg ggcacgaccg cgcaggaccc ggcgaggctt       780
     cctggtgccg tgacggagca ggtgactcgg gcggcgaact ggtcggacga cgagactcct       840
     cccgggagcg tgagcagtta cggagaggag gaggacgtgg aggagggcaa gccgtgggac       900
     cgcatgtga                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page