(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE394

MICSR_1.PE394        Location/Qualifiers
FT   CDS_pept        complement(764340..765656)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637024"
FT                   /orf_name="MICPUN_56972"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62218.1"
FT                   /db_xref="UniParc:UPI000199A991"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S1"
FT                   /transl_table=1
FT                   /translation="MAVKDELSPIVVNAWLPHKPLPGEDEEAIDKKPIDQILRGIPYRL
FT                   VNSAPKKKIVELKAALEAERAKIKEAGEGEELSEEQTATNAAAEEAIAPMEEELAAAEA
FT                   AYEELTGILCKGQLSTLPWIDSLMRYVDLGGSCIVPGGAVAADDAFRSVNGNLTDVNGM
FT                   LTEKQLAESKAWAEYITQAKLEKPGGYTIVCKYAPNPYLSAQAAIDAFPAWVERQITLG
FT                   FGVELEEGADPILPHVMLAWPDPSVPGVAEVIAKMLGPLTEDAEEGKVKAVSLDLSGDV
FT                   SCDPRPLRECLERGGTSKPSGVVVPGIHALDKVGAQLVADATRSDVKVIAGDALLGGLV
FT                   SERYLRVPAPTLAELKGTAAFAGLARVLASPGGWDGFQATLEALEATGRGVATALVQAF
FT                   ADAGMKVEIETELEKGPAFEIGEPLGEEHTAAIVAAMSA"
     atggccgtca aggacgagct ctcgccgata gtcgttaacg cgtggctccc tcacaaaccc        60
     ttaccgggcg aggacgagga ggccatcgac aagaagccca tcgaccagat cctccgcggc       120
     atcccgtaca ggctcgtcaa ctccgcgccc aagaaaaaaa tcgtcgagct gaaggctgcg       180
     ctcgaggcgg agcgcgcgaa gatcaaggag gctggcgagg gcgaggagct ctcggaggag       240
     cagaccgcga cgaatgcagc cgcggaggag gccatcgcgc cgatggagga agaactcgcc       300
     gccgcggagg ctgcctacga ggagctgacc ggcatcctct gcaaggggca attaagcacc       360
     ttgccctgga tcgactcgct catgcggtac gtcgacctcg gcgggtcgtg catcgtcccc       420
     ggcggtgccg tcgccgcgga cgacgccttc agaagcgtca acggtaacct cacggacgtc       480
     aacggcatgc tcacggagaa gcagctcgcg gaatccaagg cgtgggcaga gtacatcacg       540
     caggccaagc tggaaaagcc cggagggtac accatcgtgt gcaaatacgc gcccaacccg       600
     tacctgagcg cgcaggccgc catcgacgcc ttccctgcct gggtcgagcg gcagatcacc       660
     ctcgggttcg gggtggagct cgaggagggc gcggacccga ttctcccgca cgtcatgctc       720
     gcgtggccgg acccttccgt cccgggcgtc gccgaggtga tcgcgaaaat gctcggaccg       780
     ctgacggagg acgccgagga aggtaaggtg aaggccgtgt ccctcgacct ctccggcgac       840
     gtctcgtgcg acccgaggcc gctcagggag tgcctcgagc gtgggggcac gagcaagccg       900
     agcggcgtcg tggtcccggg gattcacgcg ctcgacaaag tcggcgcaca gctggtcgcc       960
     gacgccacgc gttccgacgt taaagtaatc gccggcgatg ccctgctcgg cggcctggta      1020
     tccgagcggt acctgcgcgt cccggcgccg acgctggcgg agcttaaggg taccgccgcg      1080
     ttcgcgggct tggcgcgcgt gctcgcgtcg cccgggggtt gggacgggtt ccaggcgacg      1140
     ctggaggcgc tggaggcgac ggggcgcggg gtggcgacgg cgctcgtgca ggcgttcgca      1200
     gacgccggga tgaaggtgga gatcgagacc gagctggaga agggaccggc gttcgagatc      1260
     ggcgagccgc tcggggagga gcacacagcc gcgatcgtcg cggcgatgtc cgcctga         1317
//

If you have problems or comments...

PBIL Back to PBIL home page