(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE395

MICSR_1.PE395        Location/Qualifiers
FT   CDS_pept        join(765945..766061,766272..766829)
FT                   /codon_start=1
FT                   /gene_family="HOG000264301" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637025"
FT                   /gene_name="SSRbeta"
FT                   /orf_name="MICPUN_112669"
FT                   /product="Translocon-associated complex trap beta subunit "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO61789.1"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG608371"
FT                   /db_xref="InterPro:IPR008856"
FT                   /db_xref="UniParc:UPI000199A992"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S2"
FT                   /transl_table=1
FT                   /translation="MFPRTAVRATLVALFVAAALFQGVVADNAPTSAHLIVHKLIIGRN
FT                   MTIEITLYNAGETAATGVEINDPGWDSSSFAMLGPSTSAKFASIPPLTKKTHRFVVVPK
FT                   VTGQFSAGPSLVSYTAGAGHQASGTSNALDPLPILTPWEAKVEVAMKIGSYLTLGFCNN
FT                   AEEWTKAAIITTVLVGLITVNWIALKGKRAVAEAQRKQAMKSLGINPKDVAVSKKQKQK
FT                   KK"
     atgttcccgc gaacggcggt ccgcgccacc ttggtggcgc tgttcgtcgc cgccgcgctc        60
     ttccagggtg tcgtcgccga caacgccccg acctccgcgc atctcattgt gcacaagctg       120
     atcatcgggc ggaacatgac catcgagatc accctgtaca acgccgggga gaccgccgcg       180
     acgggcgtgg agatcaacga ccccgggtgg gactcgtcgt ccttcgcgat gctcgggccg       240
     tcgacgtctg cgaagttcgc gtcgatccct ccgctgacga agaagacgca caggttcgtg       300
     gtggtgccca aggtgaccgg gcagttctcc gcgggtccgt cgctggtgtc gtacacggcg       360
     ggcgcgggtc accaggcgtc gggcacgagc aacgcgctgg acccgctccc catcctcacg       420
     ccatgggagg cgaaggtgga ggtggcaatg aagatcggct cgtacctgac gctgggcttc       480
     tgcaacaacg cggaggagtg gaccaaggcg gcgatcataa ccaccgttct cgtgggcctc       540
     atcaccgtca actggatagc gctcaagggt aagcgcgcgg tggcggaggc gcagcgcaag       600
     caggccatga agagcctcgg catcaacccc aaggacgtgg cggtctcgaa gaagcagaag       660
     cagaagaaga agtga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page