(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE396

MICSR_1.PE396        Location/Qualifiers
FT   CDS_pept        767031..767714
FT                   /codon_start=1
FT                   /gene_family="HOG000264300" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637026"
FT                   /orf_name="MICPUN_56974"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO61790.1"
FT                   /db_xref="InterPro:IPR019258"
FT                   /db_xref="UniParc:UPI000199A993"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S3"
FT                   /transl_table=1
FT                   /translation="MATDEEVAWCAELRRAVTSLQDSIDAARSFDHVRLPADGPVSAAD
FT                   VVEYARRISYTTFAPAGYQPGAPLHGIMPPAPQDEHFAASHLAAHAAQARQREEARRAR
FT                   EKAAEEARKAASRGEMPPIETVIKLLSAWKPGQPWPAGIPAPPPGWKPGDPLHLGAPKP
FT                   KDDGGKGSVRVEPPARVVPAAVTAPPVKPAKPVMPKVPFVKIDLHSDSDEFEEVSASDY
FT                   SSDSD"
     atggcgacgg acgaggaggt ggcgtggtgc gcggagctcc gccgcgcggt aacctccctt        60
     caggacagca tcgatgccgc gcgttccttc gaccacgtgc ggctccccgc ggacggcccg       120
     gtgagcgcgg cggacgtggt ggagtacgcg cgaaggatct cgtacacgac gttcgcgccc       180
     gcggggtatc agcccggtgc gccgctgcac gggatcatgc cgccggcgcc gcaggacgag       240
     cacttcgcgg cgtcgcacct cgcggcacac gcggcacagg cgaggcagag ggaggaggcg       300
     cggagggcta gggagaaggc tgcggaggag gcgaggaagg cggcgagcag aggggagatg       360
     ccgccgatcg agaccgtcat caagctgctg tcggcgtgga aacccgggca gccgtggccc       420
     gcggggatac ccgcgccgcc gccgggatgg aaaccggggg atccgctgca tctgggcgcg       480
     cccaagccca aggatgatgg gggtaaggga tcggtacggg tcgagccgcc cgctcgcgtg       540
     gttcccgcgg cggtgacggc accacccgtc aagccggcaa agccggtgat gcccaaggtg       600
     ccgttcgtga agatagacct ccactcggac tcggacgagt tcgaggaggt ctccgcgtcg       660
     gactactctt cggacagcga ctag                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page