(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE397

MICSR_1.PE397        Location/Qualifiers
FT   CDS_pept        769359..769808
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637027"
FT                   /orf_name="MICPUN_107918"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61791.1"
FT                   /db_xref="UniParc:UPI000199A994"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S4"
FT                   /transl_table=1
FT                   /translation="MRRKAAAGRAANADKENKESGNFALWMERGERGYTRTPGDLREVY
FT                   TAGDNAVGERGNNLYRRRHVDLLGGAASAASGIDARADRYRTTASEVSATAEEVRWEEE
FT                   NSRASEGSGLSDMASMRDAIKSASRTASERTTRSRSHLSSHVGII"
     atgaggcgta aggcggcggc gggtcgcgcc gccaacgcgg acaaggagaa caaagagtcg        60
     ggtaatttcg cgctgtggat ggagcgaggg gagcgtgggt acacgcgaac gcccggggac       120
     cttcgcgagg tgtacaccgc gggggacaac gcggttggcg agcgggggaa caacctgtac       180
     cggaggagac acgtcgacct gctcggcggc gccgcgtccg ccgcgtccgg gattgacgct       240
     cgcgcggacc gctacaggac gacagcctcc gaggtgtcag ccaccgcgga ggaggtgagg       300
     tgggaagagg agaactcgag ggcgagcgag ggaagcgggc tcagcgacat ggcgtccatg       360
     cgcgacgcca tcaagtccgc gtcacgcacc gcgtcggaga ggacgacgag gtccaggtcc       420
     cacctcagca gccacgttgg gatcatctag                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page