(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE398

MICSR_1.PE398        Location/Qualifiers
FT   CDS_pept        join(770813..770918,771034..771120,771242..771497,
FT                   771609..772287)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637028"
FT                   /orf_name="MICPUN_56977"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61792.1"
FT                   /db_xref="InterPro:IPR014854"
FT                   /db_xref="UniParc:UPI000199A995"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S5"
FT                   /transl_table=1
FT                   /translation="MPRENGVTPDGEDKESKVFRRKLRGKMRNLHKTLHESKDEIIDLT
FT                   GPVSKLGEVIEILEDIHEDVVKPREQLLDAEVMATAADLGVEMAKKMGGLGAITPAQFM
FT                   ARLCKQFVVGVDPDAQAERDEGAFNWTLFGSSVGKHFHDAPTMAFMNGAMDTQIKERRV
FT                   AQRIRRDPVGPAVAPDSVADTKADQQTDQAMKRMVKILRNKKHQNETLTVEQLSANPKS
FT                   FSQFIENIFTLSFLVKDGEAGLTPPPEGLDGPNVEKCPQVRKMKKPEEQHMDRSTFVLH
FT                   LDMEGWRRLCEANDRMEGAIPHREEVTEMDLTEGNGIGGPGAAARAEDGEEVESPGGAE
FT                   NPKGKAKPRGRGLTRPRDSTNSEERAAALRRKVAV"
     atgccgcgcg agaatggggt gacgccagat ggcgaggata aggaatccaa ggttttcagg        60
     aggaaactcc gcgggaagat gcgcaacctg cacaagaccc tgcacgaatc gaaggatgaa       120
     atcatcgacc tcaccgggcc cgtgagtaag cttggagaag tcatcgagat cctcgaggac       180
     atccacgagg atgtcgtcaa accccgcgag cagctcttgg atgccgaggt catggccacc       240
     gccgcggact tgggcgtgga gatggccaag aagatgggcg gtctgggagc gatcacgccg       300
     gcgcagttca tggcccgcct gtgcaagcag tttgtcgtgg gcgtcgaccc ggatgcccag       360
     gcggagcgcg acgagggagc gttcaactgg accttattcg gatcatccgt ggggaagcac       420
     ttccacgacg cgcccaccat ggcgttcatg aatggagcga tggacacgca gatcaaggag       480
     cgcagggtcg cgcagcgcat cagacgtgat cctgtcggtc ccgctgtcgc acccgacagc       540
     gtggccgaca cgaaggcgga ccagcagacg gaccaggcga tgaagcggat ggttaagatt       600
     ctgcgaaaca agaagcacca gaacgagacg ctcaccgtgg agcagctctc ggccaacccc       660
     aagagcttct cgcagttcat cgagaacatc ttcacgctct cgtttctggt gaaggacggt       720
     gaggcgggac tcacgccgcc gcccgagggt ctcgacggcc cgaacgtgga gaagtgcccg       780
     caggtgagga agatgaagaa gcccgaggag cagcacatgg atcgcagcac gtttgtcctg       840
     cacctcgaca tggaggggtg gaggaggctg tgcgaggcga acgatcgaat ggagggtgcc       900
     atcccgcaca gggaggaggt gacggagatg gatctgacgg aaggtaacgg gatcggcggg       960
     ccgggggcgg cggccagggc tgaggacggg gaggaggtgg agtcacccgg gggtgccgag      1020
     aacccaaagg gcaaggcgaa gccccggggg cgcggattga cccgcccgcg cgattccacc      1080
     aactcggagg agcgggcggc cgcgctgcgc aggaaggtgg cggtgtga                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page