(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE4

MICSR_1.PE4          Location/Qualifiers
FT   CDS_pept        complement(13366..14031)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636009"
FT                   /orf_name="MICPUN_56575"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62031.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199AA4B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N1"
FT                   /transl_table=1
FT                   /translation="MQFSEALFPQIFPPVEEGEDPTVMTGDFATDTQPRPGRNAFGQKP
FT                   RWPREAPGGIDRATDGPAAHVLFEPSRLHEATCKGFIEEVTWLLDSAPDEQRCTVDDLD
FT                   PGGRSPLHFAAGYGHLDIVKLLTERKCKLEVRDMWMKAPVDWAIQTEQHEIIELLRIEA
FT                   VKQKIIGGKGEVAPLKTKCEFATGKTFEEIDEFMCNWENKVWDKHERACMEERENRAP"
     atgcagttta gcgaagcgtt gttcccgcag atcttccccc cggttgaaga gggcgaggac        60
     cccacggtga tgactggcga tttcgccacc gacacccaac cccgccccgg gaggaacgcc       120
     ttcggccaga agccacgatg gccccgagag gcgcccggag gcatcgatcg cgcaaccgat       180
     gggcccgcgg cgcacgtcct gttcgaaccc tccaggctgc acgaggcgac gtgtaaggga       240
     ttcatcgagg aggtgacctg gctgctggac tccgcgcccg atgagcagag atgcacggtg       300
     gacgacctcg accccggcgg ccggtcccct ctgcatttcg cggcggggta cggccacttg       360
     gacatcgtta agctgttgac ggaacggaaa tgtaagctgg aggtgcggga catgtggatg       420
     aaggcgccgg tggattgggc gatccagacc gagcaacacg agatcatcga gcttttgcgc       480
     atcgaggcag tcaagcagaa aatcataggc gggaaaggcg aggtggcgcc tctgaagacc       540
     aagtgcgagt tcgccacagg caagacgttc gaggagatag acgagttcat gtgcaactgg       600
     gagaacaagg tatgggacaa gcacgagagg gcatgcatgg aggaaagaga gaatcgggca       660
     ccgtga                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page