(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE40

MICSR_1.PE40         Location/Qualifiers
FT   CDS_pept        complement(80012..80356)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636045"
FT                   /orf_name="MICPUN_56613"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62049.1"
FT                   /db_xref="UniParc:UPI000199AB2F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R7"
FT                   /transl_table=1
FT                   /translation="MSATPPMSHPTRPGLDDLPDPPAAPRKKKPTRSRVFPAPADDDDA
FT                   ATTPAASRRRLVFGDGGEFDSPEGGGGAGAAGGAGGTRTPASPPMTRGRASGGKEPKTP
FT                   PVSKIKSMPR"
     atgtcggcga cgcccccgat gagccacccg actcggccgg gcctcgacga cctcccggat        60
     ccacccgcgg cgcccaggaa gaagaaaccg acgcggtcgc gcgtgttccc ggcgcccgcg       120
     gacgacgacg acgcggcgac gacgccggcg gcgtcgcggc ggaggctggt gtttggcgac       180
     gggggcgagt ttgactcccc ggagggcggc ggcggcgcgg gtgccgcggg cggggcgggt       240
     gggacgagga cgcctgcgtc gccgccgatg acgcggggga gggcgagcgg gggtaaggag       300
     ccgaagaccc cgcccgtgtc caagatcaag tcgatgccga ggtag                       345
//

If you have problems or comments...

PBIL Back to PBIL home page