(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE400

MICSR_1.PE400        Location/Qualifiers
FT   CDS_pept        join(complement(775655..775798),complement(775130..775618))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637030"
FT                   /gene_name="PDI"
FT                   /orf_name="MICPUN_112673"
FT                   /product="Protein disulfide isomerase "
FT                   /function="isomerase activity"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO62220.1"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG557454"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="UniParc:UPI000199A997"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S7"
FT                   /transl_table=1
FT                   /translation="MVSSRVSGALRALIFAALIALASAAKGVVQAGDSNFDRLVLGSGK
FT                   NAFSMKPDWDKLGGHYADHPSVLIVDVDCTADGQGTCQRMGVQGYPTIKYFMSGDKKGK
FT                   DYQQGRDFNSLKSFAESKLNKPVCDAATKKGCAKNEIAFIEKHEGKSADALKEVAKEKA
FT                   DELKEIRKARSEAESELKQKQREWKKRENALNRATNILKQMQKTASA"
     atggtctcct ctcgcgtctc cggggccctt cgggctctca tcttcgccgc gctcatcgcg        60
     cttgcctccg cggccaaggg tgtcgtgcag gcgggcgaca gcaacttcga tcgcctcgtc       120
     ctgggcagcg ggaagaatgc gttctcgatg aaaccggatt gggacaagct gggaggacac       180
     tatgccgacc acccgtccgt tctcatcgtc gacgtggact gcaccgcgga cggtcagggc       240
     acctgccagc gcatgggcgt gcagggctac cccaccatca agtacttcat gagtggcgat       300
     aaaaagggta aggattacca gcagggccgc gacttcaact cgctcaagag cttcgccgag       360
     tccaagctca acaagcccgt gtgcgacgcc gccacgaaaa agggctgcgc gaagaacgag       420
     atcgccttca tcgagaagca cgagggcaag agcgcggatg cgctcaagga ggttgccaag       480
     gagaaagccg acgagctcaa ggagatccgc aaggctcggt ccgaagccga gagcgagctc       540
     aagcaaaagc agcgcgagtg gaagaagcgc gagaacgcgc tcaacagggc cacgaacatc       600
     ctcaagcaga tgcagaagac ggcctcggcg taa                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page