(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE401

MICSR_1.PE401        Location/Qualifiers
FT   CDS_pept        complement(776150..777319)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637031"
FT                   /orf_name="MICPUN_56980"
FT                   /product="Glycosyltransferase family 4 protein "
FT                   /function="transferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="ACO62221.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniParc:UPI000199A998"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S8"
FT                   /transl_table=1
FT                   /translation="MILASPDDLPPTAANPDEVGDLEQYLDAADVAVVGVLHAFKCGDV
FT                   LDQLADIKRRRGADFVPTVLVLGGTDVNVDAGDKADVLTRRAHAVDKVVSFSASMIAAA
FT                   PPGSLPSDGRTAVVPQGVSLPEEAKGVPSVEEVPSGGFEEEGFEEEGFDVADDAPSPPP
FT                   PLPLHEACGVPTSTPVFLLPAGLRPVKDVLWAVDAVDAVGAGSANASPPFVLAIVGPSL
FT                   DDKYRDAVVERLGRSKNVVLIPPVDRAHTVGYMRAATAVVNTSKSEGQSGALLEAAAAG
FT                   VPIIARDIPGNRALLDLLLDATGETPDGERDEEGFESHPCGLLCPTPESFAAALVGSAA
FT                   VRRRRSTDRAALGAGCLARNERDRWRGIIRELIGDTPEDGCGSDMAAAA"
     atgatcctcg ccagccccga cgacctaccc cccacggctg cgaatccaga cgaggtcgga        60
     gacctcgagc agtatctcga cgccgcggac gtcgccgtgg tcggcgtgct gcacgcgttc       120
     aagtgcggcg acgtcctcga tcagctcgcc gatattaaac ggcggcgcgg ggcggatttt       180
     gttcccaccg tgttggtgct tggcggcacg gacgtcaacg tcgatgccgg ggataaggcg       240
     gacgtgctga cgcgaagagc gcacgcggtg gataaggtcg tttctttctc cgcgtctatg       300
     atcgccgcgg caccgcccgg atccctgccc tccgacggga ggacggcggt ggtgccgcag       360
     ggcgtgtcgt tgccggagga agcgaagggg gttccttcag tcgaggaggt tccttcgggg       420
     ggtttcgagg aggagggttt cgaggaggag ggcttcgacg tggctgatga cgcgccctcg       480
     ccgccgccgc cgttgccgct ccacgaggcg tgcggtgtgc ccacctcgac gcccgtcttc       540
     ctcctccccg cggggttgag gcccgtcaag gacgtgttat gggcggttga cgcggttgac       600
     gccgtcggcg ccgggtccgc gaacgcgtct ccgccgtttg ttctcgccat cgtcggtccc       660
     tctctggacg acaagtaccg cgacgcggtt gtcgagcggc ttggacggtc caaaaacgtc       720
     gtgttgatcc ccccagtcga ccgcgcgcac accgtggggt acatgcgagc ggcgacggct       780
     gtcgtcaaca cgtcaaaatc cgagggtcag agcggcgccc tcctcgaggc ggccgcggcg       840
     ggcgttccca taatcgcgcg ggacattccg gggaacaggg cgttactcga ccttctgctc       900
     gacgcgacgg gtgagacgcc ggacggggag cgggacgagg aaggtttcga atcgcatccg       960
     tgcggtttgc tgtgtcccac ccccgagtcg tttgccgcgg cgttggtggg ctcggcggcg      1020
     gtacgtcggc gacgatccac ggaccgcgcc gcgctcggcg ccgggtgctt ggcgcggaac      1080
     gagcgtgatc gatggagggg tatcattcgg gagctgatcg gtgacacgcc cgaggatgga      1140
     tgcgggtcgg acatggccgc cgccgcgtga                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page