(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE402

MICSR_1.PE402        Location/Qualifiers
FT   CDS_pept        complement(777446..779152)
FT                   /codon_start=1
FT                   /gene_family="HOG000253478" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637032"
FT                   /orf_name="MICPUN_56981"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO62222.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG482141"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017806"
FT                   /db_xref="UniParc:UPI000199A9F5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S9"
FT                   /transl_table=1
FT                   /translation="MEARDRWFHGIHAHSVPVPGASPLNKSGSAPGSSSDSRILALATP
FT                   DDLVKLDLYGTLAEKHVGLTRRQVRLMYRDVRERTERVFAGLTPEQLRGKIESSLNPMD
FT                   WGLGHIAHFYEFMILRLLAPGSEPVLPGHDVHALFDSFRAAHDDRWKPKEVCGSDPTLG
FT                   EIRRYIADVTDRLVNLVGPDDDTRLDPVSTYLHVYGVVHEHWHVEDFIQTRHTLGYARP
FT                   NPLPSSPDPAVANVWGDTFAPPTFANIDSIGGIAQGAHSGFVSIPAGTYSLGATKDEPW
FT                   VFDAERWAHEIEVPAFRIAKAATTNAEFAAFIAAGGYHKRELWSHEGWRWLSRNRSEQK
FT                   SRGMSDEDAAKAGLNSEAPRYWVRKGSGEGGGFSKVAGGWHEHLFDAAPAPVRPHAPVL
FT                   HVSWYEAEAYCAWVGGRLPTEAEWEVAARTEPGNYGVVKGPRRRAYPWGDSPGPDPSRA
FT                   NLDGFRGNSVDVGSLPDGDSAWGCRQMLGNAWEWTSSAFLPYPGFQMDFPYRENSAPWF
FT                   GYRKVCKGGCWATSAPIARAGYRHSFWPEMNAVYTGFRVAVDGAPGAIGKL"
     atggaggcgc gcgaccgatg gttccatggc attcacgccc attccgtccc ggtcccgggc        60
     gcgtcccccc tcaacaaatc gggcagcgcc ccgggatctt cctcggactc caggatcctc       120
     gcgctggcaa ctcccgatga cctcgtcaag cttgacctct acggcactct cgcggagaag       180
     cacgttgggc tcaccaggag acaagtgcga ctgatgtacc gggacgtgcg cgagcgaacc       240
     gaacgcgtct tcgcgggtct cacccccgag cagctcaggg gaaaaatcga gagttcgctc       300
     aacccgatgg actggggcct cggacacatc gcgcacttct acgaattcat gatcctgcgg       360
     cttctcgcgc ccgggtccga gcccgtcctc cccggtcacg acgtccacgc gctcttcgac       420
     tcgttcaggg ccgcgcacga cgacaggtgg aaaccgaaag aggtttgcgg gagcgacccc       480
     acgctcggcg agattcgtcg atacatcgcc gacgtcaccg accgattggt taacctggtg       540
     ggtcccgacg acgacacgcg gctggacccg gtgtccacct atctgcacgt ctacggcgtc       600
     gtgcacgagc actggcacgt cgaggatttc atccagacgc gccacacgct cggttacgcc       660
     cggcccaacc cgttaccttc ctcgcccgat cccgcggtgg caaacgtgtg gggcgatacc       720
     ttcgcgccgc ccacctttgc caacatcgat tcgatcggcg gcatcgccca gggtgcccac       780
     tcggggttcg tgtccatccc cgcggggacg tattcgctcg gcgccaccaa ggatgagccg       840
     tgggtgttcg acgccgaacg ttgggcgcac gagattgaag tgccggcgtt tagaatagca       900
     aaggcggcca ccacgaacgc ggagttcgcc gcgttcatcg ccgcgggcgg gtaccataaa       960
     cgggagctgt ggtcgcacga ggggtggagg tggctgtcga ggaacaggtc ggagcagaag      1020
     agcagaggga tgagcgacga ggacgcggcg aaagccggtc tcaactcgga ggcgccgcga      1080
     tactgggtcc gcaaagggtc cggtgaaggc ggcggattca gcaaggtggc ggggggttgg      1140
     cacgaacacc tgttcgacgc ggcgcccgcg ccggtgcggc cccacgcgcc cgtgctccac      1200
     gtgagctggt acgaagccga ggcgtattgc gcgtgggtcg gcgggcggct tcccaccgag      1260
     gctgagtggg aggttgcggc gaggaccgag cccgggaact acggcgtcgt caagggcccg      1320
     aggcgcaggg cgtacccgtg gggggactcg ccgggcccgg acccgagccg cgccaacctg      1380
     gacggcttcc gcggcaacag cgtcgacgtc ggttccctac cagacggcga cagcgcgtgg      1440
     ggatgccggc agatgctggg taacgcgtgg gagtggacat ccagcgcctt cctcccttac      1500
     cccggcttcc agatggactt tccgtacagg gagaacagcg cgccgtggtt cgggtaccgc      1560
     aaggtttgca agggcggctg ctgggccacg tctgcaccga tagccagagc gggatacagg      1620
     cacagtttct ggccggagat gaacgccgtt tacaccgggt tccgcgtcgc cgtcgacggc      1680
     gcgccgggcg ccatcgggaa gctctga                                          1707
//

If you have problems or comments...

PBIL Back to PBIL home page