(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE403

MICSR_1.PE403        Location/Qualifiers
FT   CDS_pept        join(779353..780098,780169..780187)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637033"
FT                   /orf_name="MICPUN_56982"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61793.1"
FT                   /db_xref="UniParc:UPI000199A9F6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1T0"
FT                   /transl_table=1
FT                   /translation="MPSGAEGFDTNGRPDDLLKRITYNANNYGKGAFLFADADAGPEDE
FT                   SRARRNRFPKRENLELEQKLYETMERQADEVVKARLAEAEKAAKEFNWDVYVDPDANAP
FT                   VEADARPGISRPNGDGCGAAMRAALPPAEPVEPESALAAEFGARCSAKEARGALEAAGG
FT                   DLEKARKLLESLASGRGRDGLRLERKRSKDGDKGKRSRKSKKRRRKRTKYDSDSDSDSD
FT                   SSSRSSSSSSSSSSSSSSRRRRKKSKNLHIYS"
     atgccctcag gagccgaagg cttcgacacc aacggccggc ccgatgacct cctcaagcgc        60
     ataacctaca acgccaacaa ttacggcaaa ggcgcgttcc tcttcgccga cgccgacgcg       120
     ggtcccgagg atgaatcgag ggcgcgacgc aatcgcttcc ccaagcgaga gaacctcgag       180
     ctggagcaga agctgtacga gaccatggag aggcaggcgg acgaggtggt gaaggccagg       240
     ttggccgagg cggagaaggc ggctaaggag ttcaactggg acgtgtacgt ggaccccgac       300
     gcgaacgcgc cggtcgaggc ggacgcccgg ccgggaatct cgcgaccgaa cggcgacggg       360
     tgcggggcgg cgatgcgcgc ggcgctgccc cccgcggagc cggtcgaacc cgaaagcgcg       420
     ctcgcggccg agtttggcgc gaggtgttcg gccaaggagg cgcgaggcgc cctcgaagcc       480
     gccggtgggg acctggagaa ggctcgcaag ctgctggaga gcctcgcgtc ggggcgggga       540
     cgcgacggac tcagactcga gaggaaacga agcaaagacg gggacaaggg gaagaggtcg       600
     aggaagtcga agaagaggag gaggaagcga accaagtacg acagcgacag cgacagcgac       660
     agcgactcgt cgtctcgctc ttcatcgtcg tcatcgtcgt catcgtcgtc ctcgtcgagc       720
     aggcgacgca ggaagaagtc gaaaaaccta cacatctata gctag                       765
//

If you have problems or comments...

PBIL Back to PBIL home page